BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 3.6 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 8.2 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.8 bits (49), Expect = 3.6 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +3 Query: 168 QMQLRSVSPPQKPVLLAKPSSIPVKATEKTAKTGVSSKIPIVSAL--KSSSQENLAESRF 341 Q Q S PP+K L PSS ++ +E A++G P+ L + + A S F Sbjct: 312 QQQRSSPQPPEKMPRLNPPSSNTIQ-SELLARSGFQPYRPVDERLAHPAGAFPIDAYSAF 370 Query: 342 -SLPRSPP 362 S+P PP Sbjct: 371 GSIPGMPP 378 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +2 Query: 116 HNSDEHGSGKPEAIGARSDAAEIGQSAPKT 205 HN E +GK G R DA G + +T Sbjct: 307 HNGKEQRTGKDVENGGRGDALVNGNAEIRT 336 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 508,565 Number of Sequences: 2352 Number of extensions: 9033 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -