BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E09f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 24 2.7 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 6.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 24.2 bits (50), Expect = 2.7 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +2 Query: 245 GVEKYNLPLMSLANPLTVKVSKCILYKTL 331 G + ++PL+ L N V V K + YK + Sbjct: 424 GTVELSIPLIELPNAFGVSVRKYVQYKNI 452 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 23.0 bits (47), Expect = 6.2 Identities = 14/50 (28%), Positives = 20/50 (40%) Frame = -3 Query: 345 LKTIDRVLYKIHLETFTVNGFASDINGKLYFSTPNDIFYINEDAGTLDRV 196 L +DR L K++ F + G +D KL+ ED RV Sbjct: 60 LDDLDRNLRKLNSRLFVIRGQPADALPKLFKEWGTTCLTFEEDPEPFGRV 109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,135 Number of Sequences: 2352 Number of extensions: 10093 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -