BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E09f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g27945.1 68418.m03364 transducin family protein / WD-40 repea... 31 0.62 At5g25230.1 68418.m02991 elongation factor Tu family protein tra... 27 7.7 >At5g27945.1 68418.m03364 transducin family protein / WD-40 repeat family protein fizzy-related (FZR); contains 6 WD-40 repeats (PF00400); WD-repeat protein, carrot,(gi:2253631) PIR:T14352 Length = 428 Score = 30.7 bits (66), Expect = 0.62 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -3 Query: 342 KTIDRVLYKIHLETFTVNGFASDINGKLYFSTPNDIFYINEDAGTLDRVIRVQEGES 172 KTID + K H T +GF+ + YF+ P D F N + L + I + G S Sbjct: 30 KTIDSLWKKPHGSDLTWSGFSRVGVTEAYFAVPVDHFLTNPPSLRLSQTIYCRRGSS 86 >At5g25230.1 68418.m02991 elongation factor Tu family protein translation Elongation Factor 2, Schizosaccharomyces pombe, PIR:T39902 Length = 973 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = -3 Query: 351 FALKTIDRVLYKIHLETFTVNGFASDINGKLYFSTPNDIFYINEDAGTLDR 199 F L++ R+ K+H V+ FAS + G +Y+ +F + G +R Sbjct: 317 FTLQSFARMYAKLHGVAMDVDKFASRLWGDVYYHPDTRVFNTSPPVGGGER 367 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,614,214 Number of Sequences: 28952 Number of extensions: 209675 Number of successful extensions: 451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -