BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 2.9 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 6.6 AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 21 6.6 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 21 8.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.7 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -2 Query: 319 PDPITARPVPPDISASNLDIS 257 P+P+ + P PP S ++ +S Sbjct: 205 PEPVPSTPYPPPGSLGSMGVS 225 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 6.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -3 Query: 357 PPVLDGLARHPMC 319 P +DG +HP+C Sbjct: 144 PENVDGCQKHPLC 156 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 366 QAPPEPSPSIMAP 404 Q PP P P I AP Sbjct: 179 QVPPLPLPPIFAP 191 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/39 (20%), Positives = 17/39 (43%) Frame = +2 Query: 290 RHWTCSDRIWHMGCRASPSRTGGSNAGPTRTQPFDHGTI 406 RH+T S + + + + +A T +PF ++ Sbjct: 332 RHYTASSKNYRSATGGNSASNSSGDAQSTSLRPFSRWSL 370 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 255 DEMSRFEAEISGGTGRAVIGSGTWD 329 DE S I GG+ R V + WD Sbjct: 19 DESSPLTENIYGGSTRTVQETKGWD 43 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 255 DEMSRFEAEISGGTGRAVIGSGTWD 329 DE S I GG+ R V + WD Sbjct: 19 DESSPLTENIYGGSTRTVQETKGWD 43 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 255 DEMSRFEAEISGGTGRAVIGSGTWD 329 DE S I GG+ R V + WD Sbjct: 19 DESSPLTENIYGGSTRTVQETKGWD 43 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/25 (40%), Positives = 12/25 (48%) Frame = +3 Query: 255 DEMSRFEAEISGGTGRAVIGSGTWD 329 DE S I GG+ R V + WD Sbjct: 19 DESSPLTENIYGGSTRTVQETKGWD 43 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,922 Number of Sequences: 336 Number of extensions: 2373 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -