BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E07f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 32 0.20 At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containi... 27 7.7 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 27 7.7 At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating]... 27 7.7 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 32.3 bits (70), Expect = 0.20 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 273 EAEISGGTGRAVIGSGTWDAVQARLERVAPMQAPPEPSPSIMAP 404 E + G +++G+ + + + RL+R +P PP PSP P Sbjct: 32 ECNCNSGACNSLVGATYYPSCKPRLQRYSPYGNPPPPSPQYSPP 75 >At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 611 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +3 Query: 222 MEESSKFQQMQDEMSRFEAEISGGTGRAV--IGSGTWDAVQ 338 MEE ++FQ ++ E +F ISG G V + W+ ++ Sbjct: 76 MEEEARFQTLRREYKQFTRSISGKRGGDVGLMVGNPWEGIE 116 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 358 ATRSRRACTASHVPDPITARPVP 290 A RS AC +P P+ ARP P Sbjct: 103 APRSVPACPIPEIPRPVPARPTP 125 >At2g26080.1 68415.m03131 glycine dehydrogenase [decarboxylating], putative / glycine decarboxylase, putative / glycine cleavage system P-protein, putative strong similarity to SP|P26969 Glycine dehydrogenase [decarboxylating], mitochondrial precursor (EC 1.4.4.2) {Pisum sativum}; contains Pfam profile PF02347: Glycine cleavage system P-protein Length = 1044 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 175 CVNLLEFFKVKVGASSWKNPQSFNRCKMRCPGLKLKYQEALDVQ*SDLAHGMPC 336 C N+L+ K +S +PQ+ + CK R G LK +D++ D + G C Sbjct: 234 CNNILKGKKKTFVIASNCHPQTIDVCKTRADGFDLKV-VTVDIKDVDYSSGDVC 286 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,180,057 Number of Sequences: 28952 Number of extensions: 225915 Number of successful extensions: 671 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -