BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304E03f (521 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000661166 Cluster: UPI0000661166 related cluster; n... 34 2.3 UniRef50_Q5G8Y4 Cluster: Gp5; n=1; Enterobacteria phage ES18|Rep... 33 5.2 >UniRef50_UPI0000661166 Cluster: UPI0000661166 related cluster; n=1; Takifugu rubripes|Rep: UPI0000661166 UniRef100 entry - Takifugu rubripes Length = 253 Score = 33.9 bits (74), Expect = 2.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = -1 Query: 314 VTSWLYLGLMHIIKLYHISVILILRLAFQVNSSIDLWHY 198 V +W Y G+ +++LY+ + L+L + + + + LW+Y Sbjct: 62 VLTWYYTGITLVLQLYYSGITLVLHRYYTIITLVLLWYY 100 >UniRef50_Q5G8Y4 Cluster: Gp5; n=1; Enterobacteria phage ES18|Rep: Gp5 - Enterobacteria phage ES18 Length = 449 Score = 32.7 bits (71), Expect = 5.2 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 471 HKFWCNYQYVELETYYNVYSL 409 H WC Y + EL TY N+YSL Sbjct: 37 HSAWCEYGFPELVTYENLYSL 57 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,030,294 Number of Sequences: 1657284 Number of extensions: 7931909 Number of successful extensions: 13616 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13613 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 32619212418 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -