BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering In... 25 1.2 AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 25 2.0 >AY578809-1|AAT07314.1| 358|Anopheles gambiae Sloan-Kettering Institute proto-oncogeneproduct protein. Length = 358 Score = 25.4 bits (53), Expect = 1.2 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 206 FENTRISFFLSKMNNKIQLVNFYLKNCS 289 F N + F + ++N IQ + YL NC+ Sbjct: 141 FNNILMDFSVEQINRSIQELMIYLYNCT 168 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 24.6 bits (51), Expect = 2.0 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 356 FGTKRLLKKIVWFILITTTVYYYYNFSNKN 267 FGT I F+++T +YYYY S N Sbjct: 560 FGTASFA--IPCFVVLTFFIYYYYAVSTAN 587 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 521,110 Number of Sequences: 2352 Number of extensions: 10074 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -