BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D12f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 5.8 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 7.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 7.7 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.7 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 5.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 384 LFLSSS*GSVWN*TIT*KNSMVYFDNHNCVLLL 286 + LS SV + T+ K M+Y DN ++ L Sbjct: 290 ILLSDELDSVDDRTLRLKGQMIYMDNWKMMMYL 322 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -2 Query: 97 LRSNFISNMKYGTKCHNYVLQIHHN 23 L +N+ISN+ +NY ++++N Sbjct: 85 LSNNYISNISNYNNNNNYNKKLYYN 109 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -2 Query: 97 LRSNFISNMKYGTKCHNYVLQIHHN 23 L +N+ISN+ +NY ++++N Sbjct: 85 LSNNYISNISNYNNDNNYNKKLYYN 109 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -2 Query: 97 LRSNFISNMKYGTKCHNYVLQIHHN 23 L +N+ISN+ +NY ++++N Sbjct: 323 LSNNYISNISNYNNNNNYNKKLYYN 347 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,249 Number of Sequences: 438 Number of extensions: 3280 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -