BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D10f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z32683-16|CAA83631.1| 1061|Caenorhabditis elegans Hypothetical p... 29 2.0 Z32680-6|CAA83602.1| 1061|Caenorhabditis elegans Hypothetical pr... 29 2.0 >Z32683-16|CAA83631.1| 1061|Caenorhabditis elegans Hypothetical protein C28A5.6 protein. Length = 1061 Score = 29.1 bits (62), Expect = 2.0 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = -2 Query: 478 GQVGEQRLSQEGRDLLTTARAPPKET*QLKSNCFANESTTGSESRPAEKIRRETQRADAW 299 G+VGE++ S++ D++ + AP E + + NE E EK+ E ++A A Sbjct: 164 GEVGEKKESEQPTDMVEPSSAPTTEETETE-----NEEEDDKEKTDKEKLDAEKEKALAE 218 Query: 298 VRL 290 RL Sbjct: 219 KRL 221 >Z32680-6|CAA83602.1| 1061|Caenorhabditis elegans Hypothetical protein C28A5.6 protein. Length = 1061 Score = 29.1 bits (62), Expect = 2.0 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = -2 Query: 478 GQVGEQRLSQEGRDLLTTARAPPKET*QLKSNCFANESTTGSESRPAEKIRRETQRADAW 299 G+VGE++ S++ D++ + AP E + + NE E EK+ E ++A A Sbjct: 164 GEVGEKKESEQPTDMVEPSSAPTTEETETE-----NEEEDDKEKTDKEKLDAEKEKALAE 218 Query: 298 VRL 290 RL Sbjct: 219 KRL 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,680,105 Number of Sequences: 27780 Number of extensions: 197110 Number of successful extensions: 499 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -