BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D10f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ... 31 0.36 At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein ... 29 2.5 At2g33350.1 68415.m04088 hypothetical protein 28 4.4 At2g02310.1 68415.m00169 F-box family protein / SKP1 interacting... 28 4.4 >At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 237 Score = 31.5 bits (68), Expect = 0.36 Identities = 18/70 (25%), Positives = 33/70 (47%) Frame = -2 Query: 499 KAFPVSPGQVGEQRLSQEGRDLLTTARAPPKET*QLKSNCFANESTTGSESRPAEKIRRE 320 K FP + +Q+L+++ LTT +P K +++S + + SE E+ + Sbjct: 151 KLFPEYVEKYNQQQLAEQATTQLTTPESPQKSDTKVESEKTIDPTKGDSEGGLKERKKNN 210 Query: 319 TQRADAWVRL 290 Q AW+ L Sbjct: 211 KQGLPAWIIL 220 >At3g01030.1 68416.m00004 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 353 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 16 GLESIRKYMKSASERYFDKAMRHDNRLIVAAADYSPNPDHAGAS 147 GLE K + S ++ D +R++ RL+ A D +P G S Sbjct: 175 GLEHFGKALGSTQRKFEDGLLRNEQRLVGEALDSNPEKKLVGIS 218 >At2g33350.1 68415.m04088 hypothetical protein Length = 440 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +1 Query: 22 ESIRKYMKSASERYFDKAMRHDNRLIVA 105 E IR+YMK +ER F+K +++ R +A Sbjct: 343 EKIRRYMKKRNERNFNKKIKYACRKTLA 370 >At2g02310.1 68415.m00169 F-box family protein / SKP1 interacting partner 3-related contains similarity to SKP1 interacting partner 3 GI:10716951 from [Arabidopsis thaliana] Length = 307 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = -2 Query: 382 CFANESTTGSESRPAEKIRRETQRADAWVRLHVDLFVEFDEYGYRG 245 CF +EST ++ P +K+ + +R D W+ + F F++ G G Sbjct: 232 CF-DESTDKTKEWPKKKLMKSKKRGDGWMEAEIGDF--FNDGGLMG 274 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,282,778 Number of Sequences: 28952 Number of extensions: 187887 Number of successful extensions: 451 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 444 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -