BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D08f (467 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21326| Best HMM Match : Myosin_head (HMM E-Value=5e-05) 29 2.5 SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.7 >SB_21326| Best HMM Match : Myosin_head (HMM E-Value=5e-05) Length = 469 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 37 VSRRIFSVGRVSDPVVNSAKHGS 105 ++RRI S R S PV+N + HGS Sbjct: 44 IARRINSFKRQSSPVINGSPHGS 66 >SB_52012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1143 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 306 RNQCLLVELNSSREPALRTTSCFVVQRLCSA*QLQIMTDIV 428 RN+ ++VE+ +S EPA +T +C Q Q D++ Sbjct: 781 RNEDIVVEVPASNEPAAKTEDEIRKAEMCKFEQAQEAEDLI 821 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,625,069 Number of Sequences: 59808 Number of extensions: 203792 Number of successful extensions: 480 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 969807871 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -