BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D08f (467 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 pr... 24 3.0 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 5.3 >AY028786-1|AAK32960.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 23.8 bits (49), Expect = 3.0 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 214 KNIEAKANPTFCF*RRQIQSSIVTQITRSIN 306 KN+ AK PTF + ++ S VT + + Sbjct: 125 KNLRAKLTPTFTSGKMKLMFSTVTAVAEEFD 155 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 5.3 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -3 Query: 369 NWLSAALVPVTNSIQLVNIDSVYRPCNLC-NYRALYLSALEA 247 NWL + + +L+++DS+Y C L N Y+ +EA Sbjct: 688 NWLQKSNIDSRTQPRLMDLDSIY--CKLLYNRGRTYVPLVEA 727 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 430,483 Number of Sequences: 2352 Number of extensions: 7696 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40820256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -