BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D08f (467 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81557-1|CAB04535.1| 343|Caenorhabditis elegans Hypothetical pr... 28 2.9 AC024797-3|AAF60706.1| 112|Caenorhabditis elegans Hypothetical ... 27 6.7 >Z81557-1|CAB04535.1| 343|Caenorhabditis elegans Hypothetical protein F59A1.3 protein. Length = 343 Score = 28.3 bits (60), Expect = 2.9 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = -3 Query: 369 NWLSAALVPVTNSIQLVNIDSVYRPCNLCNYRALYL 262 ++++A+L ++NSI L+ + P N+CNYR L L Sbjct: 11 SYINASLAFISNSI-LICLIITKTPRNMCNYRHLML 45 >AC024797-3|AAF60706.1| 112|Caenorhabditis elegans Hypothetical protein Y48G8AR.3 protein. Length = 112 Score = 27.1 bits (57), Expect = 6.7 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 337 RHGNQRCGQPVVLSSNGCALRNSYRS*PI--LLNLRFYYIPIEE 462 ++GNQRC + + C LRN + L N+R Y I E+ Sbjct: 58 KNGNQRCFEGSIYVKELCGLRNGTKVFKFIELANIRLYSIDEED 101 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,390,859 Number of Sequences: 27780 Number of extensions: 156256 Number of successful extensions: 271 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -