BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1334 - 32723950-32724121,32724527-32724558,32724665-327247... 29 3.0 04_04_1335 - 32730516-32730570,32730655-32731154,32731235-327314... 28 4.0 >04_04_1334 - 32723950-32724121,32724527-32724558,32724665-32724708, 32724962-32725123,32725984-32726422 Length = 282 Score = 28.7 bits (61), Expect = 3.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 208 LAINIASGAGFY*FKLNSLELQKHFRCNNIC 116 L ++I G FY + + ELQ++ R NNIC Sbjct: 165 LFVDIVLGYMFYKLSILAAELQRNGRANNIC 195 >04_04_1335 - 32730516-32730570,32730655-32731154,32731235-32731416, 32732673-32732779,32733364-32733395,32733499-32733542, 32733816-32733977,32734356-32734755 Length = 493 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -2 Query: 208 LAINIASGAGFY*FKLNSLELQKHFRCNNIC 116 L ++I G FY + S ELQ++ + NNIC Sbjct: 152 LFVDIVLGYIFYKLSILSAELQRNGKANNIC 182 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,990,735 Number of Sequences: 37544 Number of extensions: 203634 Number of successful extensions: 357 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 357 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -