BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 192 1e-49 SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) 30 1.0 SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) 28 5.4 SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) 27 7.1 SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) 27 9.4 SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) 27 9.4 SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) 27 9.4 SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61) 27 9.4 SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) 27 9.4 SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) 27 9.4 SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) 27 9.4 SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021) 27 9.4 SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) 27 9.4 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 192 bits (469), Expect = 1e-49 Identities = 94/148 (63%), Positives = 113/148 (76%) Frame = +3 Query: 78 EDSKKLPAVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKE 257 +D K+P VPE++LK + L ++ K++EIFKRAE+YVKEYR KE Sbjct: 3 QDRVKVPRVPETLLKKRKSLEQIKAARAKAQLAQKKLQHGKRKEIFKRAEKYVKEYRQKE 62 Query: 258 RDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPKVRKVLQLFRLRQINNGVFVRL 437 DE+R+ + A+ GN+YVP EA+LAFVIRIRGIN VSPKVRK+LQL RLRQINNGVFVRL Sbjct: 63 VDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKVRKILQLLRLRQINNGVFVRL 122 Query: 438 NKATVNMLRIAEPYIAWGYPNLKSVREL 521 NKAT NMLRI +PYIA+GYPNLKSVREL Sbjct: 123 NKATANMLRIVQPYIAFGYPNLKSVREL 150 >SB_38639| Best HMM Match : Avirulence (HMM E-Value=1.5) Length = 546 Score = 30.3 bits (65), Expect = 1.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 277 PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRRSV 381 P +HA T P + N H +S S +T RRSV Sbjct: 318 PFRHATTTITVLPSRYNNHTASSSHATTTIQRRSV 352 >SB_16234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1150 Score = 29.5 bits (63), Expect = 1.8 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 2/78 (2%) Frame = -2 Query: 433 RTNTPLFIWRSLNSCRTLRTFGETWLIPRIRMTNANLASPGT**LPRLRACLASLISSRS 254 RT PLF L C R TW P + + + L + +A L+ +RS Sbjct: 295 RTRAPLFYSFLLTGCTARRRENVTW-FPSMALAGSILLKQRCSDMNTTACIMAVLVKTRS 353 Query: 253 LMRYSLTY--CSALLKIS 206 + ++ L + CS+ ++IS Sbjct: 354 MEQFLLLFIVCSSEIQIS 371 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 180 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 305 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 180 RSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRGNY 305 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_8804| Best HMM Match : RGS (HMM E-Value=1.5e-37) Length = 712 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 252 KERDEIRLARQARNRGNYYVP 314 K RD +AR+ R+RG YY+P Sbjct: 483 KIRDTSSIARETRSRGPYYLP 503 >SB_56940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1981 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 270 RLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPKVRK 383 RL R + R NYY+ + +AF + I + + P R+ Sbjct: 1886 RLRRTEKRRQNYYIATQKLMAFALNIYEVLKDDPLTRR 1923 >SB_50079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 490 PQAM*GSAIRSIFTVALFRRTNTPLFIWRSLNSCRTLRTFG 368 P+ + + + +++V+L R N LF RSL SC RT+G Sbjct: 428 PRVLCATLLPVVYSVSLDSRYNE-LFTGRSLQSCGNQRTWG 467 >SB_44267| Best HMM Match : DUF602 (HMM E-Value=1.1e-29) Length = 482 Score = 27.5 bits (58), Expect = 7.1 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 2/80 (2%) Frame = +3 Query: 63 PVKGKEDSKKLP--AVPESVLKHXXXXXXXXXXXLQVTLKRRSSAIKKKREIFKRAEQYV 236 P K KE SK + AV +S+LK + T ++ AI KKR + +Y+ Sbjct: 305 PAK-KESSKHIEKNAVKKSILKAPKRNAKKAATDAEQTTTKK--AIDKKRRRYNSRRRYI 361 Query: 237 KEYRIKERDEIRLARQARNR 296 + R R R R R Sbjct: 362 RRRRFTSRRRATRRRYTRRR 381 >SB_47959| Best HMM Match : rve (HMM E-Value=3e-29) Length = 622 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 370 EWCKATMEASYTMNITYHRAIKC 392 >SB_39528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1029 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 841 EWCKATMEASYTMNITYHRAIKC 863 >SB_34135| Best HMM Match : rve (HMM E-Value=3e-29) Length = 324 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 289 EWCKATMEASYTMNITYHRAIKC 311 >SB_29251| Best HMM Match : rve (HMM E-Value=2.3e-29) Length = 324 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 289 EWCKATMEASYTMNITYHRAIKC 311 >SB_25312| Best HMM Match : Vicilin_N (HMM E-Value=0.61) Length = 219 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 64 EWCKATMEASYTMNITYHRAIKC 86 >SB_17925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1075 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = -2 Query: 274 SLISSRSLMRYSLTYCSALLKISLFFLMAEERLFSVTCNLLVRRASLLLRCLSTDS 107 SL SR+ M Y LK++L L+ ++ L S C+L R ++ +S D+ Sbjct: 142 SLAISRNQMELFGLYAGMRLKVALVGLIYKKILNSSRCSLSTVRTGHVINLISNDA 197 >SB_2841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3297 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 1011 EWCKATMEASYTMNITYHRAIKC 1033 >SB_54416| Best HMM Match : rve (HMM E-Value=1.4e-27) Length = 1068 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 470 EWCKATMEASYTMNITYHRAIKC 492 >SB_39493| Best HMM Match : zf-TRAF (HMM E-Value=1.5e-09) Length = 310 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 330 PIWLPRERSSCHDCVLVWLV*FHHVP 253 P+ P E S C CVL WL ++ P Sbjct: 28 PLMAPCEHSYCSACVLGWLTHYNTCP 53 >SB_12133| Best HMM Match : DUF827 (HMM E-Value=0.64) Length = 325 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = +3 Query: 159 LQVTLKRRSSAIKKKREIFKRAEQYVKEYRIKERDEIRLARQARNRG 299 L+ L+ R I+K AE+ +K R+KE D I + +RG Sbjct: 219 LRQALRERDRLIEKINSAVMSAEEQLKVRRLKEDDSIDQLSRHEHRG 265 >SB_3768| Best HMM Match : Involucrin (HMM E-Value=0.021) Length = 205 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 64 EWCKATMEASYTMNITYHRAIKC 86 >SB_2192| Best HMM Match : rve (HMM E-Value=4e-23) Length = 491 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +2 Query: 416 QWCVCTSE*GYCEYATYRRALHC 484 +WC T E Y TY RA+ C Sbjct: 281 EWCKATMEASYTMNITYHRAIKC 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,537,292 Number of Sequences: 59808 Number of extensions: 287198 Number of successful extensions: 726 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 724 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -