BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304D04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 3.6 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 23 4.7 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 23 4.7 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 23 4.7 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 23 6.2 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 23 6.2 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.8 bits (49), Expect = 3.6 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +3 Query: 207 EIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAK 326 E+F+++ Q +E+ I D I L QAR Y P E++ Sbjct: 255 EMFRQSVQEREEHGIVRPDLIHLLIQARKGQLRYQPQESE 294 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.4 bits (48), Expect = 4.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 134 ERGSSH*EITGYAKEAFFCHQEEEGNL 214 +R + H E A E+F C+ E GNL Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.4 bits (48), Expect = 4.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 134 ERGSSH*EITGYAKEAFFCHQEEEGNL 214 +R + H E A E+F C+ E GNL Sbjct: 119 DRPAPHDEACERAYESFRCYYEHYGNL 145 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.4 bits (48), Expect = 4.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +2 Query: 134 ERGSSH*EITGYAKEAFFCHQEEEGNL 214 +R + H E A E+F C+ E GNL Sbjct: 135 DRPAPHDEACERAYESFRCYYEHYGNL 161 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 143 SSH*EITGYAKEAFFCHQEEEGNL 214 S H ++ A E+F C+ E+ GN+ Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 143 SSH*EITGYAKEAFFCHQEEEGNL 214 S H ++ A E+F C+ E+ GN+ Sbjct: 122 SPHVDVCERAYESFRCYYEQYGNI 145 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 486,598 Number of Sequences: 2352 Number of extensions: 9243 Number of successful extensions: 62 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -