BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304C06f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59890.2 68418.m07511 actin-depolymerizing factor 4 (ADF4) id... 63 1e-10 At5g59890.1 68418.m07510 actin-depolymerizing factor 4 (ADF4) id... 63 1e-10 At4g00680.1 68417.m00093 actin-depolymerizing factor, putative s... 62 2e-10 At1g01750.1 68414.m00094 actin-depolymerizing factor, putative s... 62 3e-10 At3g46010.1 68416.m04978 actin-depolymerizing factor 1 (ADF1) id... 61 5e-10 At3g46000.1 68416.m04977 actin-depolymerizing factor, putative (... 59 2e-09 At5g52360.1 68418.m06497 actin-depolymerizing factor, putative s... 59 2e-09 At4g25590.1 68417.m03687 actin-depolymerizing factor, putative s... 58 3e-09 At3g45990.1 68416.m04976 actin-depolymerizing factor, putative s... 57 6e-09 At5g59880.1 68418.m07508 actin-depolymerizing factor 3 (ADF3) id... 56 2e-08 At2g31200.1 68415.m03810 actin-depolymerizing factor 6 (ADF6) id... 54 6e-08 At2g16700.1 68415.m01916 actin-depolymerizing factor 5 (ADF5) id... 53 1e-07 At4g34970.1 68417.m04957 actin-depolymerizing factor, putative s... 49 2e-06 At5g63320.1 68418.m07946 expressed protein 31 0.36 At5g43930.1 68418.m05374 transducin family protein / WD-40 repea... 29 2.5 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 29 2.5 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 28 4.4 At5g28810.1 68418.m03542 hypothetical protein 27 5.8 At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3)... 27 5.8 At1g64430.1 68414.m07302 expressed protein 27 5.8 >At5g59890.2 68418.m07511 actin-depolymerizing factor 4 (ADF4) identical to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana} Length = 132 Score = 62.9 bits (146), Expect = 1e-10 Identities = 25/58 (43%), Positives = 41/58 (70%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKL 341 +K K+F ++WCPD AKV+ KM+Y+SS D K+ L G+Q +QATD +E + ++ ++ Sbjct: 74 QKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVLKSRV 131 >At5g59890.1 68418.m07510 actin-depolymerizing factor 4 (ADF4) identical to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana} Length = 139 Score = 62.9 bits (146), Expect = 1e-10 Identities = 25/58 (43%), Positives = 41/58 (70%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKL 341 +K K+F ++WCPD AKV+ KM+Y+SS D K+ L G+Q +QATD +E + ++ ++ Sbjct: 81 QKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVLKSRV 138 >At4g00680.1 68417.m00093 actin-depolymerizing factor, putative strong similarity to SP|P30175 Actin-depolymerizing factor (ADF) {Lilium longiflorum}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 140 Score = 62.5 bits (145), Expect = 2e-10 Identities = 26/58 (44%), Positives = 42/58 (72%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKL 341 +K K+F ++W PDT++V+ KMLY+SS D K+ + G+Q +QATD SE S + ++ +L Sbjct: 81 QKSKIFFIAWSPDTSRVRSKMLYASSKDRFKREMEGIQVELQATDPSEMSLDIIKGRL 138 >At1g01750.1 68414.m00094 actin-depolymerizing factor, putative strong similarity to SP|P30175 Actin-depolymerizing factor (ADF) {Lilium longiflorum}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 140 Score = 61.7 bits (143), Expect = 3e-10 Identities = 26/58 (44%), Positives = 42/58 (72%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKL 341 +K K+F ++W PDT++V+ KMLY+SS D K+ L G+Q +QATD SE S + ++ ++ Sbjct: 81 QKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVELQATDPSEMSLDIIKGRV 138 >At3g46010.1 68416.m04978 actin-depolymerizing factor 1 (ADF1) identical to SP|Q39250 Actin-depolymerizing factor 1 (ADF-1) (AtADF1) {Arabidopsis thaliana} Length = 139 Score = 60.9 bits (141), Expect = 5e-10 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSE 371 +K K+F ++WCPD AKV+ KM+Y+SS D K+ L G+Q +QATD +E Sbjct: 81 QKSKIFFIAWCPDIAKVRSKMIYASSKDRFKRELDGIQVELQATDPTE 128 >At3g46000.1 68416.m04977 actin-depolymerizing factor, putative (ADF2) strong similarity to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 137 Score = 59.3 bits (137), Expect = 2e-09 Identities = 25/57 (43%), Positives = 39/57 (68%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 344 +K K+F ++W PDTAKV+ KM+Y+SS D K+ L G+Q +QATD +E + + + Sbjct: 79 QKSKIFFIAWSPDTAKVRDKMIYASSKDRFKRELDGIQVELQATDPTEMGLDVFKSR 135 >At5g52360.1 68418.m06497 actin-depolymerizing factor, putative strong similarity to pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum] GI:22857914; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 137 Score = 58.8 bits (136), Expect = 2e-09 Identities = 24/57 (42%), Positives = 41/57 (71%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 344 +K K+F ++W PD+++V+ KM+Y+SS D K+ L G+Q +QATD SE S + ++ + Sbjct: 79 QKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPSEMSLDIIKSR 135 >At4g25590.1 68417.m03687 actin-depolymerizing factor, putative strong similarity to pollen specific actin-depolymerizing factor 2 [Nicotiana tabacum] GI:22857914; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 130 Score = 58.4 bits (135), Expect = 3e-09 Identities = 24/57 (42%), Positives = 41/57 (71%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 344 +K K+F ++W PD+++V+ KM+Y+SS D K+ L G+Q +QATD SE S + ++ + Sbjct: 72 QKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPSEMSFDIIKSR 128 >At3g45990.1 68416.m04976 actin-depolymerizing factor, putative similar to SP|Q9ZSK3 Actin-depolymerizing factor 4 (ADF-4) (AtADF4) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 133 Score = 57.2 bits (132), Expect = 6e-09 Identities = 23/57 (40%), Positives = 40/57 (70%) Frame = -2 Query: 511 KQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKL 341 ++K+ ++W P TAK++KKM+YSS+ D K+ L G+Q ATDL++ S +A+ ++ Sbjct: 76 ERKICFIAWSPSTAKMRKKMIYSSTKDRFKRELDGIQVEFHATDLTDISLDAIRRRI 132 >At5g59880.1 68418.m07508 actin-depolymerizing factor 3 (ADF3) identical to SP|Q9ZSK4 Actin-depolymerizing factor 3 (ADF 3) (AtADF3) {Arabidopsis thaliana} Length = 139 Score = 55.6 bits (128), Expect = 2e-08 Identities = 22/56 (39%), Positives = 38/56 (67%) Frame = -2 Query: 511 KQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 344 + ++F ++W PDTA+V+ KM+Y+SS D K+ L G+Q +QATD +E + + + Sbjct: 82 RSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATDPTEMDLDVFKSR 137 >At2g31200.1 68415.m03810 actin-depolymerizing factor 6 (ADF6) identical to SP|Q9ZSK2 Actin-depolymerizing factor 6 (ADF-6) (AtADF6) {Arabidopsis thaliana} Length = 146 Score = 54.0 bits (124), Expect = 6e-08 Identities = 23/57 (40%), Positives = 36/57 (63%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEK 344 +K K+F +W P T+ ++ K+LYS+S D L + L G+ IQATD +E E + E+ Sbjct: 88 QKSKIFFFAWSPSTSGIRAKVLYSTSKDQLSRELQGIHYEIQATDPTEVDLEVLRER 144 >At2g16700.1 68415.m01916 actin-depolymerizing factor 5 (ADF5) identical to SP|Q9ZNT3 Actin-depolymerizing factor 5 (ADF-5) (AtADF5) {Arabidopsis thaliana} Length = 143 Score = 53.2 bits (122), Expect = 1e-07 Identities = 19/59 (32%), Positives = 41/59 (69%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLR 338 +K K+F ++W P+ +K++ K+LY++S D L++ L G+ +QATD +E + ++++ + Sbjct: 85 RKSKIFFIAWSPEASKIRAKILYATSKDGLRRVLEGIHYELQATDPTEMGFDIIQDRAK 143 >At4g34970.1 68417.m04957 actin-depolymerizing factor, putative similar to SP|Q9ZNT3 Actin-depolymerizing factor 5 (ADF-5) (AtADF5) {Arabidopsis thaliana}; contains Pfam profile PF00241: Cofilin/tropomyosin-type actin-binding protein Length = 130 Score = 48.8 bits (111), Expect = 2e-06 Identities = 17/59 (28%), Positives = 40/59 (67%) Frame = -2 Query: 514 KKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASQEAVEEKLR 338 + K+F ++W P+ +++++KM+Y++S L++ L GV +QATD +E + ++++ + Sbjct: 72 RMSKIFFITWSPEASRIREKMMYATSKSGLRRVLDGVHYELQATDPTEMGFDKIQDRAK 130 >At5g63320.1 68418.m07946 expressed protein Length = 569 Score = 31.5 bits (68), Expect = 0.36 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 2/64 (3%) Frame = -1 Query: 479 GHRQGQEEDVVL*LVRRSEKVPCRSSEVHPSDRPLGSVSGGRR--REAPRHRSPINSIYT 306 G ++ QE +VV + +E V EVHP DR G R RE PR S+ Sbjct: 311 GDKEEQETEVVDMRKQENEVVDMGVEEVHPLDRSEGRTLSPHRKEREDPRASGNEESVSE 370 Query: 305 RARD 294 +A+D Sbjct: 371 KAQD 374 >At5g43930.1 68418.m05374 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to WD-repeat protein 5 (SP:Q9UGP9) [Homo sapiens] Length = 726 Score = 28.7 bits (61), Expect = 2.5 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -1 Query: 380 PLGSVSGGRRREAPRHRSPINSIYTRARDETEPALRHSCPDDTRP 246 PL + SG + SP N TRA D T PA+ D+ +P Sbjct: 307 PLATSSGPSGPNSVPGNSPSNIFLTRAGDRTSPAVDGMDVDEAQP 351 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +2 Query: 128 AGGGGTYPRGLTRGPTTSKINHINTIRFP 214 +GGG + PR +R P I+ + T+ FP Sbjct: 441 SGGGSSSPRSESRAPIDDVIDRVTTMGFP 469 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 27.9 bits (59), Expect = 4.4 Identities = 24/79 (30%), Positives = 33/79 (41%), Gaps = 1/79 (1%) Frame = +3 Query: 36 DIYNIN-VPPI*LQRLPRPSNRNALLLHGRNRQGAVVPTRADSQEVLPPVKSIILILFVF 212 DI I P I + L S++ L+ R + D + L P K ++ +LF F Sbjct: 165 DIKEIRFTPKIEAKDLKFKSDQALKLMESGYRVKCLAVPDKDKHKELEPEK-LLELLFRF 223 Query: 213 LCNNTKRLVVSWPRVVRAG 269 C LV SWP R G Sbjct: 224 TCFIGDALVESWPEADRKG 242 >At5g28810.1 68418.m03542 hypothetical protein Length = 560 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Frame = +3 Query: 267 GVSES-GFGFVASSCVNAVYWRSVARSFSSTA 359 G+ E+ GFG +CV + WRS + F+ TA Sbjct: 185 GIGEACGFGKTTLTCVPLLDWRSSRKRFNFTA 216 >At4g25540.1 68417.m03682 DNA mismatch repair protein MSH3 (MSH3) identical to SP|O65607 DNA mismatch repair protein MSH3 (AtMsh3) {Arabidopsis thaliana} Length = 1081 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +3 Query: 177 PVKSIILILFVFLCNNTKRLVVSWPRVVRAGVSESGFGFVASSCVNAVYWRSVARSFS 350 PV S + + +V + N+TK+ + P + AG+ E + VN W S +SFS Sbjct: 679 PVDSKVPMNWVKV-NSTKKTIRYHPPEIVAGLDELALATEHLAIVNRASWDSFLKSFS 735 >At1g64430.1 68414.m07302 expressed protein Length = 559 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 254 CRQGRSVGERVRFRRELVCKCCLLAIGGAE 343 CR G S E V F + + C CL+AI A+ Sbjct: 180 CRVGISPAEEVPFGKIVRCPSCLIAIAVAQ 209 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,287,742 Number of Sequences: 28952 Number of extensions: 234453 Number of successful extensions: 718 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -