BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304C04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0233 - 15548622-15548651,15548811-15548916,15549574-155497... 28 5.2 >07_03_0233 - 15548622-15548651,15548811-15548916,15549574-15549725, 15550208-15550252,15550663-15550866 Length = 178 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -1 Query: 173 TPQILSIRVFWSLKLSTLKCNTKVLWTCIYQLYFVLKCTNKY 48 T IL + W L LS C+ + WT + +F ++ + Y Sbjct: 34 TTYILLLFFAWLLVLSVSACSPGIAWTVVNLAHFAVELKSNY 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,555,787 Number of Sequences: 37544 Number of extensions: 170297 Number of successful extensions: 335 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -