BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304C03f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 1.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.6 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +3 Query: 255 HIRSRQELGEGTPTAGLSVDSDRSGGQQERPR 350 +++ E E PT + S + ERPR Sbjct: 79 NVKKEDESDEEKPTTSFKLKDSSSDSEDERPR 110 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 6.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 110 TEIIINYTLKQI*SLIVNVKLENLEQKSKMTTNKHG 3 TEI +N T + S+ +VKL +L S M + G Sbjct: 319 TEIFLNITGDKTNSVFEHVKLGSLYHISFMACSSAG 354 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,360 Number of Sequences: 336 Number of extensions: 2060 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -