BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304B12f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 28 4.1 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/51 (23%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 512 MFII*LVKYKF*ALHLWAEIECVNISKIWNVL-FLNNNKSVFIFFFYVYRI 363 +F++ ++ + + L LW + + + WNV+ F+ N ++ Y+YR+ Sbjct: 840 VFVLFILFFSYKELKLWVKQGWNHFKEFWNVVEFVINVSALIAIALYIYRM 890 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,423,706 Number of Sequences: 59808 Number of extensions: 253945 Number of successful extensions: 422 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 411 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 422 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -