BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304B12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 4.7 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 8.2 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 4.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 81 KKHKQLSPDIIDVLTHH 31 +++K PDI+ VL HH Sbjct: 2439 QRYKSNVPDIVGVLNHH 2455 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 8.2 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 193 VCNRLKTW*WVLNPLDDTRPYKQHT*TKGAFNRMMVVKK 77 VC RL+ VLN D R + K F+ ++VKK Sbjct: 264 VCTRLEDLRMVLNQTQDHRAIVLASVAKELFSWRIMVKK 302 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 480,178 Number of Sequences: 2352 Number of extensions: 8560 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -