BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ovS304B12f
(521 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AK128535-1|BAC87487.1| 208|Homo sapiens protein ( Homo sapiens ... 29 9.9
>AK128535-1|BAC87487.1| 208|Homo sapiens protein ( Homo sapiens
cDNA FLJ46693 fis, clone TRACH3012864. ).
Length = 208
Score = 29.1 bits (62), Expect = 9.9
Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 3/53 (5%)
Frame = -2
Query: 154 PLDDTRPYKQ---HT*TKGAFNRMMVVKKT*TIIT*YNRCPHSPRTTDVSLRN 5
P D+ P++Q H KG F +++++ ++ N+CPH T V ++N
Sbjct: 119 PAGDSIPWQQKRKHGLLKGRFLVCLLLRENLFVLVCVNQCPHLRDVTTVKMQN 171
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 64,686,661
Number of Sequences: 237096
Number of extensions: 1153563
Number of successful extensions: 1514
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1501
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1514
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4990119376
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -