BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304B11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 27 0.50 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 26 0.88 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 25 1.2 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 25 1.2 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 25 2.0 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 6.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 6.2 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 6.2 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 6.2 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 8.2 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 23 8.2 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 26.6 bits (56), Expect = 0.50 Identities = 16/53 (30%), Positives = 26/53 (49%) Frame = +1 Query: 145 KLAEQAERYDEMVEAMKNVASRNVSDNELTVEERNLLSVAYKNVIGARRASWR 303 KL+ E+ + ++ + K RN+ N VE R+ S+ Y V+ SWR Sbjct: 702 KLSLAPEKTELLMISSKRSGYRNIPVNICGVEVRSKRSIRYLGVMLHDHLSWR 754 Score = 24.6 bits (51), Expect = 2.0 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 201 SITQRVRQ*ADSGGEEPAVGRLQERDRR 284 S Q ++Q D+G ++GR RDRR Sbjct: 544 STLQAIQQVVDAGRRALSLGRTNNRDRR 571 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.8 bits (54), Expect = 0.88 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQNLAS 506 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.2 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELLVREQNLAS 506 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 25.4 bits (53), Expect = 1.2 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERNLLS 258 + +LAE+ R ++ EA VAS N + EL V E+NL S Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELLVREQNLAS 506 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 24.6 bits (51), Expect = 2.0 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Frame = -3 Query: 81 NPNRQV--TYSPRWPRPPT 31 +P+R + T RWPRPPT Sbjct: 13 SPSRPILTTRGRRWPRPPT 31 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.2 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 214 RCVMLHSSSPPPFRHSAQPAQLTLLYTHYL--PFPTLWMTNDFTLTKSES 71 RC + SPP HS+Q T T P P T T T S Sbjct: 6 RCSPQSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGAS 55 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.2 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = -2 Query: 214 RCVMLHSSSPPPFRHSAQPAQLTLLYTHYL--PFPTLWMTNDFTLTKSES 71 RC + SPP HS+Q T T P P T T T S Sbjct: 6 RCSPQSAPSPPHHHHSSQSPTSTTTVTMATASPVPACTTTTSTTSTSGAS 55 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +1 Query: 319 EQKEETKGAEDKLNMIRAYRSQVEKELRDICSDIL 423 E+KEE K E+KL + + RD+ + +L Sbjct: 154 EEKEEAKRREEKLEAQMEKLAAAHQRDRDVLNSLL 188 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.0 bits (47), Expect = 6.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 139 KAKLAEQAERYDEMV-EAMKNVASRNVSDNELTVEERN 249 + +LAE+ R ++ EA VAS N + EL V E+N Sbjct: 466 ETQLAEENARLKKLNGEADLAVASANATLQELVVREQN 503 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 22.6 bits (46), Expect = 8.2 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 186 GDEECSITQRVRQ*ADSGGEEPAVGRLQE 272 G S T+R Q A SGG AV +LQ+ Sbjct: 81 GSASRSETERELQQALSGGNSQAVPKLQD 109 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 379 SQVEKELRDICSDILGV 429 S VEK+LRD+ +++ GV Sbjct: 350 SDVEKDLRDLFTELDGV 366 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 522,492 Number of Sequences: 2352 Number of extensions: 10668 Number of successful extensions: 51 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -