BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304B08f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1156 - 30814037-30814190,30814277-30815166 31 0.42 08_02_0459 + 17420156-17420976,17422291-17424199 27 6.9 >03_05_1156 - 30814037-30814190,30814277-30815166 Length = 347 Score = 31.5 bits (68), Expect = 0.42 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 268 VNLIQFQYIKISSLFFYYI--ELQNQRTNTVLKVIQFC 375 V L+ F Y+ + L FY + E+ +RTN VL + FC Sbjct: 67 VGLLLFIYLLVGVLAFYAVMDEISGKRTNRVLDALYFC 104 >08_02_0459 + 17420156-17420976,17422291-17424199 Length = 909 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 89 NIFKETWQNYNGQEVHKPVNKFIISI 12 N+ + QNYNG VH V FIIS+ Sbjct: 479 NLLQLEKQNYNGCRVHDTVLDFIISM 504 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,257,033 Number of Sequences: 37544 Number of extensions: 190694 Number of successful extensions: 320 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 320 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -