BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304B07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57900| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_49434| Best HMM Match : CBFD_NFYB_HMF (HMM E-Value=3.6e-08) 35 0.035 SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33336| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.25 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 32 0.25 SB_34924| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 32 0.33 SB_12411| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 32 0.33 SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.44 SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) 31 0.58 SB_3487| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_47052| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.3 SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_14358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 29 3.1 SB_8368| Best HMM Match : VWA (HMM E-Value=0) 28 4.1 SB_4664| Best HMM Match : DSPc (HMM E-Value=7.2) 28 4.1 SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) 28 4.1 SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) 28 5.4 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) 27 7.1 SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) 27 7.1 SB_14879| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) 27 7.1 SB_8972| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_27766| Best HMM Match : Exo_endo_phos (HMM E-Value=0.26) 27 9.4 SB_59666| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) 27 9.4 >SB_57900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 52.0 bits (119), Expect = 3e-07 Identities = 25/64 (39%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = +3 Query: 333 ATEADNNKLEFELNSEEQVHEKKQKTEV-IRSTKLPIARIKNIMKMDPDVNIVSSDAVFL 509 A E++N + + N++E++H Q+ E R T+ P R++N+MK+DPD+ + + +AVFL Sbjct: 3 AEESEN--MATQDNNDEELHPATQEEEKPSRMTQFPQTRVRNMMKLDPDLQLANKEAVFL 60 Query: 510 VTKA 521 VT+A Sbjct: 61 VTRA 64 >SB_49434| Best HMM Match : CBFD_NFYB_HMF (HMM E-Value=3.6e-08) Length = 120 Score = 35.1 bits (77), Expect = 0.035 Identities = 12/32 (37%), Positives = 25/32 (78%) Frame = +3 Query: 426 TKLPIARIKNIMKMDPDVNIVSSDAVFLVTKA 521 T+LP+++IK I+K PD+ +S +++FL+ ++ Sbjct: 14 TQLPLSKIKTILKSSPDLANISQESLFLIARS 45 >SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1275 Score = 33.5 bits (73), Expect = 0.11 Identities = 23/78 (29%), Positives = 36/78 (46%) Frame = +3 Query: 252 EDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTEVIRSTK 431 E +++ E +S+ ENE L ++ +E DN + N+ E V E K + Sbjct: 915 ESTEVAAFGEEVQSFSENETLCVSIKPDSEGDNEEHTNGNNNAETV-EHKNADMACSQPE 973 Query: 432 LPIARIKNIMKMDPDVNI 485 L A K+I K P+V I Sbjct: 974 LTKAEDKSIAKRKPEVTI 991 >SB_36640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 33.1 bits (72), Expect = 0.14 Identities = 20/67 (29%), Positives = 32/67 (47%) Frame = +3 Query: 213 PSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVH 392 P+S+ EEE E+V+ + E E E E + E E + K E E EE+ Sbjct: 190 PASVVEEEEEEEEEEVEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEKEEEEEEEEEEEE 249 Query: 393 EKKQKTE 413 E++++ E Sbjct: 250 EEEEEEE 256 >SB_33336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 309 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/67 (26%), Positives = 37/67 (55%), Gaps = 4/67 (5%) Frame = +3 Query: 234 SEEECHED----VDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKK 401 +EE+ H++ +D S++TE + EN+ L+ T+ TE + ++ +E V+ ++ Sbjct: 172 AEEKYHKNNENVLDASELTEREQKQTENDQLEDKTTQTTETPQKPKQHDV-AETNVNTRR 230 Query: 402 QKTEVIR 422 +K E R Sbjct: 231 RKKENAR 237 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 32.3 bits (70), Expect = 0.25 Identities = 25/75 (33%), Positives = 41/75 (54%), Gaps = 4/75 (5%) Frame = +3 Query: 252 EDVDISD--ITEH-SESYLENEHLKFALTEATEADNNKLEFELNSE-EQVHEKKQKTEVI 419 ED++I + H +E E LK L +A E D +L+ E+ S EQ+HE + EVI Sbjct: 2514 EDLEIERDRVKRHLAELTAEKNTLKTRL-DARELDIVRLQSEVKSSVEQLHEVRTHVEVI 2572 Query: 420 RSTKLPIARIKNIMK 464 R+ + ++ KN ++ Sbjct: 2573 RTENVSSSKDKNFIE 2587 >SB_34924| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 206 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/110 (20%), Positives = 48/110 (43%), Gaps = 1/110 (0%) Frame = +3 Query: 180 RKRLLLHRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKL 359 RKR++ RK+ QN EE +TE + L + Sbjct: 67 RKRIITARKHLQGEEQNNEEERSRRP---RVLTEEQRARQRQRDLVLTEEQRVRKRQTSS 123 Query: 360 EFELNSEEQVHEKKQKTEV-IRSTKLPIARIKNIMKMDPDVNIVSSDAVF 506 E+ L+ E++V +K++ ++ + + R +N+ K++ +++ D++F Sbjct: 124 EYRLSGEQRVRKKQKDSKYELDDEQRASKRQRNLEKLNAQRTMMAEDSLF 173 >SB_12411| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 167 Score = 31.9 bits (69), Expect = 0.33 Identities = 22/110 (20%), Positives = 48/110 (43%), Gaps = 1/110 (0%) Frame = +3 Query: 180 RKRLLLHRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKL 359 RKR++ RK+ QN EE +TE + L + Sbjct: 28 RKRIITARKHLQGEEQNNEEERSRRP---RVLTEEQRARQRQRDLVLTEEQRVRKRQTSS 84 Query: 360 EFELNSEEQVHEKKQKTEV-IRSTKLPIARIKNIMKMDPDVNIVSSDAVF 506 E+ L+ E++V +K++ ++ + + R +N+ K++ +++ D++F Sbjct: 85 EYRLSGEQRVRKKQKDSKYELDDEQRASKRQRNLEKLNAQRTMMAEDSLF 134 >SB_36081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 424 Score = 31.5 bits (68), Expect = 0.44 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 Query: 198 HRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTE 332 H+K K S + EE E+ DIS + E+ E + + K A TE Sbjct: 377 HKKEKKSKKEKTKTEESDEEADISAVLENGEKKKKKKKKKKAKTE 421 >SB_29594| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.4e-06) Length = 1292 Score = 31.1 bits (67), Expect = 0.58 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +3 Query: 252 EDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTE 413 ED +S+ T E+ EN LK + DN L +L+S Q+H+K + E Sbjct: 514 EDNSLSE-TSQMENLRENLKLKQMTVQQLNKDNEALREKLSSSVQIHDKVAELE 566 >SB_3487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/44 (34%), Positives = 29/44 (65%) Frame = +3 Query: 330 EATEADNNKLEFELNSEEQVHEKKQKTEVIRSTKLPIARIKNIM 461 +A + DN+K+ +L+S E V E+K +TE+ +S ++KN++ Sbjct: 59 KALKEDNDKMSQDLSSLE-VLEQKSETEIRKSAPFATNKVKNLI 101 >SB_47052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 516 Score = 29.1 bits (62), Expect = 2.3 Identities = 23/76 (30%), Positives = 34/76 (44%) Frame = +3 Query: 180 RKRLLLHRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKL 359 R LL++ KY+ S++ M +E H + + T H ES + L L E N L Sbjct: 241 RPNLLINAKYEQSAMSMMIGKEAHFIAILREPTTHFESAFYSYRLDALL--GLENATNPL 298 Query: 360 EFELNSEEQVHEKKQK 407 + L S + EK K Sbjct: 299 QAFLTSPHEHVEKYLK 314 >SB_22651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.7 bits (61), Expect = 3.1 Identities = 27/101 (26%), Positives = 44/101 (43%) Frame = +3 Query: 195 LHRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELN 374 L R KP + SEEE E+ + + TE + + LK TE + D+ L E + Sbjct: 636 LPRTKKPEKEEEESEEESEEESEEEEETEK----VNKDALKAKATEKSN-DSLCLSEEES 690 Query: 375 SEEQVHEKKQKTEVIRSTKLPIARIKNIMKMDPDVNIVSSD 497 EE+ E+ ++ E + A+I + + V V D Sbjct: 691 EEEESEEESEEDEEEGAKPSASAKIAKTSETENKVPKVDKD 731 >SB_14358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/72 (29%), Positives = 39/72 (54%), Gaps = 2/72 (2%) Frame = -3 Query: 402 VSSHVLVPQSLVQILVCYYLLL*PPSV--QI*DVHFLDKIPNAL*YLKCRHLRGILLQTY 229 V H+++P + + LVC ++ L P++ + VH IPN + L C H+R I+ Sbjct: 40 VHVHLIIP-NFIAPLVCVHVHLIIPNMITPLVCVHVHLIIPNLIALLVCVHVRLIIPNMI 98 Query: 228 FVTMKVYIYGVI 193 + M V+++ +I Sbjct: 99 TLLMCVHVHLII 110 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +3 Query: 219 SLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFEL 371 S++ + ++ E +++ + H L +E + ALT+ TEA+N++L+ EL Sbjct: 269 SVEQLRKQHAEEMIEVENYVSHIRQ-LSDE--REALTQDTEAENDQLKAEL 316 >SB_8368| Best HMM Match : VWA (HMM E-Value=0) Length = 771 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +3 Query: 405 KTEVIRSTKLPIARIKNIMKMDPDVNIVSSDAVFLVT 515 K + +R ++ +AR++ KM PDV +VS A+ L T Sbjct: 73 KRQGLRPSEDFVARLRTSAKMTPDVRLVSGVALMLRT 109 >SB_4664| Best HMM Match : DSPc (HMM E-Value=7.2) Length = 247 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 267 SDITEHSESYLENEHLKFALTEATEADNNK 356 SD T +S+ ENE L F + TE DN + Sbjct: 107 SDATADVQSFSENETLCFTIKPDTEGDNKR 136 >SB_23388| Best HMM Match : ParBc (HMM E-Value=0.3) Length = 1168 Score = 28.3 bits (60), Expect = 4.1 Identities = 21/71 (29%), Positives = 36/71 (50%), Gaps = 5/71 (7%) Frame = +3 Query: 237 EEECHEDVDISDITEHSESYLENEHLKFALTEATEADN-NKLEFE----LNSEEQVHEKK 401 E+E ++VD+ + H S LE HLK E D+ N + FE L +E ++ +KK Sbjct: 648 EDEETDEVDVLEEQRHRISSLEG-HLKLVEKARLEDDDRNNINFEEYKRLRNELEILKKK 706 Query: 402 QKTEVIRSTKL 434 + E ++ + Sbjct: 707 RAQEELQEAMM 717 >SB_53565| Best HMM Match : Amino_oxidase (HMM E-Value=9.7e-19) Length = 438 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/72 (27%), Positives = 35/72 (48%) Frame = +3 Query: 234 SEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTE 413 +EEE E+ + + E E E E E + + + E E EE+ E++++ E Sbjct: 31 AEEEEEEEEEEEEEEEEEEEEEEEEE------EEEDKEEEEEEEEEEEEEEEEEEEEEEE 84 Query: 414 VIRSTKLPIARI 449 V+ TK+ +RI Sbjct: 85 VLLKTKIWQSRI 96 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 27.9 bits (59), Expect = 5.4 Identities = 20/49 (40%), Positives = 28/49 (57%) Frame = +3 Query: 261 DISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQK 407 D+S + EH S LE E+LKF A+ K +L+SE++ EKK K Sbjct: 1637 DVS-MLEHKVSSLEEENLKFRRVLEEYANEVK---QLHSEKEDLEKKTK 1681 >SB_18600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2388 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/66 (27%), Positives = 28/66 (42%) Frame = +3 Query: 237 EEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTEV 416 E E E D E SES E+E + E E++ + E EE++ EK ++ Sbjct: 682 ESEGEESEQEDDDKEESESESESEESEEESEEEEESEESDSEESEEEEEEIKEKDIAEQL 741 Query: 417 IRSTKL 434 K+ Sbjct: 742 EEENKI 747 >SB_11347| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1234 Score = 27.9 bits (59), Expect = 5.4 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 1/78 (1%) Frame = +3 Query: 273 ITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTEVIRSTKL-PIARI 449 +T HS S L +L+ +AT+ + + F+L +EQV + + TE L P ++ Sbjct: 396 LTNHSASELARLYLQAKAMDATKMKDGRRGFDL--DEQVLDVVKTTEKREFLTLDPQEKL 453 Query: 450 KNIMKMDPDVNIVSSDAV 503 K I+ + DV +S+DA+ Sbjct: 454 KVIVALCHDV--LSTDAL 469 >SB_49900| Best HMM Match : GETHR (HMM E-Value=5e-18) Length = 1044 Score = 27.5 bits (58), Expect = 7.1 Identities = 21/108 (19%), Positives = 45/108 (41%), Gaps = 5/108 (4%) Frame = +3 Query: 183 KRLLLHRKYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLE 362 KR + + K S+ S +E H + DIT E+ E+ + + T+ ++ ++ Sbjct: 567 KRRISKMRKKSRSIDITSLKETHREDRAIDITSLKETQREDRAIDMTSLKETQREDRAID 626 Query: 363 FELNSEEQVHEKKQKTEVIRSTK-----LPIARIKNIMKMDPDVNIVS 491 E Q ++ ++ T+ + I +K + D ++I S Sbjct: 627 ITSLKETQREDRAIDMTSLKETQREDRAIDITSLKETQREDRAIDITS 674 >SB_36579| Best HMM Match : C1_1 (HMM E-Value=0.00011) Length = 633 Score = 27.5 bits (58), Expect = 7.1 Identities = 22/86 (25%), Positives = 40/86 (46%) Frame = +3 Query: 204 KYKPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEE 383 K + L+ +E+ + DI + + E+ + LT T+AD+ +L + E+ Sbjct: 169 KTQVKELREEVDEKTKQVTDIESKVKQLKEERESLSAQLELT-LTKADSEQLARSIAEEQ 227 Query: 384 QVHEKKQKTEVIRSTKLPIARIKNIM 461 +K+KT + K IAR K+ M Sbjct: 228 YSDLEKEKTMIELEVKELIARHKSEM 253 >SB_14879| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 222 LQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLE 362 L ++ +C + + ++ HS +EN HL+F L + A L+ Sbjct: 221 LDDLDVLKCAQKTEECEVLVHSLQMMENPHLRFLLAAVSPAAKAALQ 267 >SB_11244| Best HMM Match : M (HMM E-Value=2.5e-08) Length = 1381 Score = 27.5 bits (58), Expect = 7.1 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = +3 Query: 216 SSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFEL-NSEEQVH 392 S + S+EE ++++ + + Y+ +EH K + E T A+ +E L NS E Sbjct: 1036 SFYDSSSDEENDAPSELNNAPQKLKDYVRSEHFKSSFKE-TRAEKKSMERRLENSSEDFK 1094 Query: 393 EKKQKTEVIRSTKLPI 440 Q+ + + + I Sbjct: 1095 AMLQRMQKLDKENVQI 1110 >SB_8972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 342 ADNNKLEFELNSEEQVHEKKQKTEVIRSTKLPIARIKNIMKMDPDVNIVSS 494 + K FE +S+++ + K+ V RSTKL R+ K + VNI S Sbjct: 14 SSERKKSFEPDSKQRPRDHNYKSTVPRSTKLSYRRMDVHGKDNQPVNIKKS 64 >SB_27766| Best HMM Match : Exo_endo_phos (HMM E-Value=0.26) Length = 348 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/76 (21%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +3 Query: 243 ECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLEFELNSEEQVHEKKQKTEVIR 422 E H +DIS++ E + N++L + + +D N + + H + + VI Sbjct: 72 EMHSVLDISNLNEGINLHTPNQNLLYIQCDTQPSDKNNIGETETGPTRRHLRAKVPNVIV 131 Query: 423 STKLPIA-RIKNIMKM 467 S + +A +I ++++ Sbjct: 132 SNVMSLAPKIDEVIEL 147 >SB_59666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/51 (21%), Positives = 24/51 (47%) Frame = +3 Query: 210 KPSSLQNMSEEECHEDVDISDITEHSESYLENEHLKFALTEATEADNNKLE 362 K + + +S E D++I + + LEN H+K ++ D ++ + Sbjct: 37 KTDTDEGLSHSEDERDIEIDVVGQDDVGILENNHVKMVEEPESQVDKDQCD 87 >SB_58665| Best HMM Match : TSP_1 (HMM E-Value=7.5e-10) Length = 718 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = +1 Query: 142 SACKTILARRYILEKDYYYTVNINLHRYKIC 234 SACK L+ ++ILEK+ V + +HR + C Sbjct: 545 SACKCNLSVKFILEKEQKQPVGL-MHRMRRC 574 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,931,952 Number of Sequences: 59808 Number of extensions: 192979 Number of successful extensions: 628 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 589 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 626 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -