BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 6.2 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 8.2 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/20 (55%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -2 Query: 67 FLLL-GKGNHGQRCHQNNRV 11 FLL+ GK +HG+ H+ NRV Sbjct: 961 FLLVNGKISHGELLHRMNRV 980 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 50 FAKEEKGTPKAVEEKKQDKRGIYDIGSYGGHNF 148 FAK + K EE + KRGI+ + + G F Sbjct: 968 FAKRREAVEKFNEEHRWRKRGIHVVPTMFGIAF 1000 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 394,337 Number of Sequences: 2352 Number of extensions: 6950 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -