BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A10f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 26 0.88 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.6 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 6.2 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 23 8.2 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 23 8.2 AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. 23 8.2 AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. 23 8.2 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 23 8.2 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 8.2 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -1 Query: 317 CMKNCAVNSSSYFLPLVAFSAALVTLPPP 231 C + C+ N S F P V + +PPP Sbjct: 42 CSRKCSRNGSPKFAPAVQSKNRMPPVPPP 70 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 3.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 80 LEMQPLSTWYLPSLYV*SP 136 LE PL++W LP YV P Sbjct: 632 LEPVPLASWQLPPPYVTEP 650 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = -1 Query: 224 LKLTALMTPTATVCLMSRTAKRPRGGNSW 138 L L + A VCLM PR +W Sbjct: 17 LALNTMRVERADVCLMVELHSVPRNNGNW 45 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 22.6 bits (46), Expect = 8.2 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = -1 Query: 266 AFSAALVTLPPPASLKLTALMTPTATVCLMSRTAKRP 156 A S V PP S TA T T T + K P Sbjct: 559 ATSPPAVATPPSTSRARTATRTATTTTRALRSAKKEP 595 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 239 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 132 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 >AY344834-1|AAR05805.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 239 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 132 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 >AY344833-1|AAR05804.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 239 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 132 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 239 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 132 PPP + T + PTAT T P +W D Sbjct: 211 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 241 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 22.6 bits (46), Expect = 8.2 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 239 PPPASLKLTALMTPTATVCLMSRTAKRPRGGNSWKD 132 PPP + T + PTAT T P +W D Sbjct: 212 PPPPTTTTTVWIDPTATT-----TTHAPTTTTTWSD 242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 473,763 Number of Sequences: 2352 Number of extensions: 8988 Number of successful extensions: 49 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -