BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A08f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 26 0.23 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 5.0 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 25.8 bits (54), Expect = 0.23 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 317 FYSTIYLFIYSKIQHELAP*WRGFYYLVTH 406 F+ST+ L I S+ Q A W+ Y V H Sbjct: 149 FHSTLLLMILSRYQRLKAQLWQNRYETVAH 178 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 5.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 235 KNPTLKNVCTYIDFQYSISS 176 K TLK YIDF Y + S Sbjct: 133 KIQTLKLAARYIDFLYHVLS 152 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,154 Number of Sequences: 336 Number of extensions: 2218 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -