BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A08f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0305 - 2181727-2184793,2185635-2185945 27 6.9 06_01_0754 - 5644310-5646292 27 9.1 >07_01_0305 - 2181727-2184793,2185635-2185945 Length = 1125 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = -2 Query: 271 LHGFVCTKFSHEKNPTLKNVCTYIDFQYSISSVRTQRQIRSYE 143 +HG T S KNP L+ + SIS + +RS+E Sbjct: 992 IHGEDITDISFSKNPKLEKIVWSFREMKSISGIERLPSLRSFE 1034 >06_01_0754 - 5644310-5646292 Length = 660 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -2 Query: 265 GFVCTKFSHEKNPTLKNVCTYIDFQYSISSVRTQRQIRS 149 G +C++ E P+++ VC Y+D + + T I S Sbjct: 588 GLMCSQARPEARPSMRQVCRYLDGEEMLQEDATPAAIFS 626 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,615,809 Number of Sequences: 37544 Number of extensions: 175405 Number of successful extensions: 297 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 297 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -