BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A08f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9208| Best HMM Match : p450 (HMM E-Value=0) 29 3.1 SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) 27 9.4 >SB_9208| Best HMM Match : p450 (HMM E-Value=0) Length = 544 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -2 Query: 328 CRIKPRL-FVTRFC*FIY--MSLHGFVCTKFSHEKNPTLKNV 212 CR+ P L V RF + +S HGFVC S E P N+ Sbjct: 102 CRMLPSLAIVQRFSNSAFDDISTHGFVCVVCSSETTPVALNI 143 >SB_22953| Best HMM Match : EGF_2 (HMM E-Value=1.3e-14) Length = 635 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 293 KSCYEQSWFYSTIYLFIYSKIQ 358 K CYEQ Y T+Y +Y K Q Sbjct: 57 KVCYEQKVAYRTVYKQLYRKAQ 78 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,149,425 Number of Sequences: 59808 Number of extensions: 229593 Number of successful extensions: 432 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 432 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -