BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A08f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CY... 25 2.0 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 24 3.6 >AF487534-1|AAL93295.1| 509|Anopheles gambiae cytochrome P450 CYP6P3 protein. Length = 509 Score = 24.6 bits (51), Expect = 2.0 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 318 FILQSIYLFIRKYNTNWHHNG 380 F + +YLFIR + W NG Sbjct: 13 FAVSIVYLFIRNKHNYWKDNG 33 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +1 Query: 160 DAAF*RSK*NTGNQCMYTHFLTSDFFHEKTSCKQSRGGTYK*INKILLRTIVVL 321 DA R + N+ ++T + + ++ C Q + GT+ +N I + VV+ Sbjct: 584 DALLKREFPDLQNRTIFTGRFVKELYDVRSGCVQEQDGTHLLMNLIKVNDPVVM 637 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 453,764 Number of Sequences: 2352 Number of extensions: 8930 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -