BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A03f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0437 + 3390099-3392570 31 0.56 >03_01_0437 + 3390099-3392570 Length = 823 Score = 31.1 bits (67), Expect = 0.56 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 412 KKKDGFFSQIENLGIINSNLVYLSIYKLYTKVL 510 +K + +F ++ G+ S +Y S+ KLYTKV+ Sbjct: 581 QKAEAYFGLLKKAGLCESATIYNSLIKLYTKVV 613 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,511,726 Number of Sequences: 37544 Number of extensions: 173764 Number of successful extensions: 341 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -