BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS304A03f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047662-3|AAC04443.2| 263|Caenorhabditis elegans Hypothetical ... 28 4.7 AC006617-9|AAF39767.1| 409|Caenorhabditis elegans Hypothetical ... 27 8.1 >AF047662-3|AAC04443.2| 263|Caenorhabditis elegans Hypothetical protein T22B2.5 protein. Length = 263 Score = 27.9 bits (59), Expect = 4.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -1 Query: 179 FRVISWSYFVFVSRICTVVYCSL 111 FRVI W + VF+ +C VY SL Sbjct: 131 FRVIFWIFIVFI-HLCQAVYVSL 152 >AC006617-9|AAF39767.1| 409|Caenorhabditis elegans Hypothetical protein C39B5.2 protein. Length = 409 Score = 27.1 bits (57), Expect = 8.1 Identities = 14/39 (35%), Positives = 24/39 (61%) Frame = +3 Query: 315 MLVLYSTMDDNFSKCSTYVIFRIEITLVITKLKKKGWLF 431 +++ YS +DD F KC + RI L+ +++KK+ LF Sbjct: 225 IIINYSFLDDVFLKCPNSQVARI-YGLIDSRIKKECCLF 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,561,749 Number of Sequences: 27780 Number of extensions: 204082 Number of successful extensions: 502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 502 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -