BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303H10f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096,255... 32 0.32 03_04_0127 - 17508808-17509029,17509195-17509938,17510004-175102... 30 0.98 02_05_0959 + 33086498-33086544,33087295-33087967,33088665-330890... 30 1.3 06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327,504... 29 1.7 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 1.7 02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 29 1.7 08_02_1437 - 27096364-27097252,27098931-27099022,27099382-270996... 29 2.3 10_07_0138 + 13325418-13325954 29 3.0 01_06_0213 + 27580635-27581105,27581206-27581298,27581376-275815... 28 4.0 06_03_1158 - 28080330-28080647,28080726-28080949,28081213-280814... 27 6.9 03_04_0122 + 17465804-17465893,17466028-17466147,17466287-174663... 27 6.9 02_04_0039 - 19118632-19118820,19119018-19119395,19120151-191203... 27 6.9 02_04_0035 + 19078267-19078479,19078588-19078674,19079792-190798... 27 6.9 01_01_0084 - 636835-637965 27 6.9 05_04_0126 + 18252594-18256922 27 9.1 01_01_0089 - 699533-699643,699738-700046,700134-700220,700298-70... 27 9.1 >09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096, 2550893-2550988,2551418-2551482,2551558-2551591, 2552469-2552540,2552567-2552644,2553416-2553477, 2554267-2554530,2555057-2555246,2555432-2555500, 2555613-2555669,2555746-2555846,2556029-2556146, 2556225-2556272,2556362-2556487,2556960-2557118, 2558119-2558216,2558324-2558416,2559741-2559937, 2560231-2560354,2561121-2561334,2561773-2561830, 2561955-2562433 Length = 1022 Score = 31.9 bits (69), Expect = 0.32 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 379 PRVEEPPPTTASVPPDVSPTADSWEVE 459 PRVE PPP+ A+ PP + P D + E Sbjct: 62 PRVEGPPPSPATAPPMLHPREDDEDEE 88 >03_04_0127 - 17508808-17509029,17509195-17509938,17510004-17510242, 17510334-17510436,17510666-17510770,17510838-17510906, 17510998-17511402,17512048-17512156,17512240-17512295 Length = 683 Score = 30.3 bits (65), Expect = 0.98 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 70 LRSATIMSNNGAPDSWENEAEIIGE 144 L I +NN AP SW N +IIGE Sbjct: 397 LEDRIICTNNSAPLSWYNRTQIIGE 421 >02_05_0959 + 33086498-33086544,33087295-33087967,33088665-33089058, 33089140-33089210,33089373-33089497,33089705-33089821, 33094128-33094238,33094321-33094413,33094726-33094984, 33095067-33095189 Length = 670 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +1 Query: 145 KGAKDSNDVSSKISTLNVNAMEFVPS-FSKP 234 KG + + S ++TLN NA EFVPS F P Sbjct: 29 KGGDAGSKLPSTVTTLNPNAAEFVPSTFRSP 59 >06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327, 5048453-5048834,5049389-5050126 Length = 531 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 175 SKISTLNVNAMEFVPSFSKPSQASDS 252 +K++ LN NA EFVPS +PS S + Sbjct: 19 NKVTALNPNAAEFVPSCIRPSFESSA 44 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +1 Query: 379 PRVEEPPPTTASVPPDVSPTADSWE 453 P +PPP PPD P D+W+ Sbjct: 213 PVTPQPPPPPPPPPPDSKPGVDTWD 237 >02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 Length = 197 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +1 Query: 385 VEEPPPTTASVPPDVSPTADSWEVEAD 465 ++EPPP A P S TA W ++AD Sbjct: 5 IDEPPPAPAPPQPKQSTTARRWWMKAD 31 >08_02_1437 - 27096364-27097252,27098931-27099022,27099382-27099654, 27099872-27100819 Length = 733 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +1 Query: 106 PDSWENEAEIIGEKGAKDSNDVSSKISTLNVNAMEFVPSFSKPSQASDSTDSPTS 270 P N AEI + K ++ +S + ++ E V S +KP+ A + SPTS Sbjct: 158 PSVKNNGAEIKKPQLTKSNSSLSKQALNSIIDKKEVVSSKTKPTSARSTPSSPTS 212 >10_07_0138 + 13325418-13325954 Length = 178 Score = 28.7 bits (61), Expect = 3.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 423 GRDRCSSRWWFFNTWRSRC 367 G RCS RW WRSRC Sbjct: 83 GARRCSRRWRRSRRWRSRC 101 >01_06_0213 + 27580635-27581105,27581206-27581298,27581376-27581540, 27581640-27581862,27582329-27582429,27582666-27582713, 27583086-27583172,27583745-27583879,27583985-27584140, 27585336-27585545,27585641-27586351,27586429-27586974, 27587872-27588495,27588595-27588699,27590460-27590711, 27590939-27591766 Length = 1584 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 145 KGAKDSNDVSSKISTLNVNAMEFV-PSFSKPSQASDSTDSP 264 K K+ D ++ S L + E PS KPS A+ S+DSP Sbjct: 692 KREKEKVDALTQSSDLTTSGKEAPKPSLGKPSSANTSSDSP 732 >06_03_1158 - 28080330-28080647,28080726-28080949,28081213-28081423, 28081536-28081708,28082093-28082156,28082353-28082514 Length = 383 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -3 Query: 279 FLGGGRGIGTIASLRRLRKRRHEFHGIYIQRGNF*RHIIRILCTFFTYY 133 F GG + +R + H+ H IY+ G++ H++R +FF Y Sbjct: 84 FTGGSHSLMGKELVREITDLAHK-HDIYVSTGDWAEHLLRQGPSFFKQY 131 >03_04_0122 + 17465804-17465893,17466028-17466147,17466287-17466317, 17466978-17467153,17468051-17468142,17468259-17468340, 17468498-17468566,17468655-17468759,17471246-17471342, 17471438-17471676,17472191-17472949,17473079-17473297 Length = 692 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 70 LRSATIMSNNGAPDSWENEAEIIGE 144 L + +NN P W+N +IIGE Sbjct: 403 LEDHIVCANNSTPLPWQNRTQIIGE 427 >02_04_0039 - 19118632-19118820,19119018-19119395,19120151-19120345, 19120425-19120502,19120567-19120752,19120828-19121058, 19121137-19121490,19121588-19121785,19121869-19122039, 19122156-19122263,19122362-19122580,19122665-19122871, 19122978-19123196,19123315-19123389,19123749-19123901 Length = 986 Score = 27.5 bits (58), Expect = 6.9 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +1 Query: 70 LRSATIMSNNGAPDSWENEAEIIGEKGAKDSNDVSSKISTLNVNAMEFVP-SFSKPSQAS 246 ++ +++ A +SW + G +GA S D ++ ++ E VP S +P+ S Sbjct: 779 VKGEIVLAQFSADNSWNRAMIVNGPRGAVSSQDDKFEVFYIDYGNQEVVPYSRIRPADPS 838 Query: 247 DSTDSPTSPQ 276 S+ SP Q Sbjct: 839 ISS-SPALAQ 847 >02_04_0035 + 19078267-19078479,19078588-19078674,19079792-19079863, 19080338-19080526,19080599-19080718,19081348-19081430, 19081518-19081773,19081878-19082199,19086355-19086548, 19087135-19087227,19089327-19089497,19089580-19089699, 19090303-19090373,19090608-19090675,19091097-19091191 Length = 717 Score = 27.5 bits (58), Expect = 6.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -3 Query: 270 GGRGIGTIASLRRLRKRR 217 GGRG+GT+ RR KR+ Sbjct: 503 GGRGVGTVEEARRKEKRK 520 >01_01_0084 - 636835-637965 Length = 376 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +1 Query: 379 PRVEEPPPTTASVPPDVSPTADSWEVE-ADDALLT 480 P PPPT++++P + P+ W + AD AL T Sbjct: 28 PGAAPPPPTSSALPTQIPPS--DWSLSPADPALAT 60 >05_04_0126 + 18252594-18256922 Length = 1442 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 134 ISASFSHESGAPLLDIIVAERKINNL 57 + S SHE G PL ++ RKIN + Sbjct: 923 VDPSTSHEMGKPLRSAVLIPRKINKM 948 >01_01_0089 - 699533-699643,699738-700046,700134-700220,700298-700469, 700547-701373,701487-701559,701993-702078,702153-702227, 702308-702548,702905-703239,703328-703414,703497-703640, 703714-704670 Length = 1167 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/58 (27%), Positives = 30/58 (51%) Frame = +1 Query: 70 LRSATIMSNNGAPDSWENEAEIIGEKGAKDSNDVSSKISTLNVNAMEFVPSFSKPSQA 243 ++ I+ NNG D +N A +G+K K D + K + + ++ F PS +P+ + Sbjct: 1049 MKQIGILCNNGG-DEIKNFALDLGKKLNKVLGDCNYKTVSFDEKSLSFFPSCVQPNDS 1105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.313 0.129 0.385 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,978,234 Number of Sequences: 37544 Number of extensions: 217106 Number of successful extensions: 851 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 793 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -