BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303H08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60380.1 68416.m06753 expressed protein 35 0.038 At1g15780.1 68414.m01893 expressed protein 31 0.47 At1g62220.1 68414.m07018 expressed protein 30 0.82 At1g55080.1 68414.m06291 expressed protein 29 1.4 At1g25540.1 68414.m03171 phytochrome and flowering time regulato... 29 1.4 At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 29 1.9 At5g62570.1 68418.m07852 calmodulin-binding protein similar to c... 28 4.4 At5g18270.2 68418.m02148 no apical meristem (NAM) family protein... 27 5.8 At5g18270.1 68418.m02147 no apical meristem (NAM) family protein... 27 5.8 At3g18810.1 68416.m02389 protein kinase family protein contains ... 27 5.8 At3g14320.1 68416.m01811 zinc finger (C3HC4-type RING finger) fa... 27 5.8 At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containi... 27 5.8 At2g45620.1 68415.m05672 nucleotidyltransferase family protein l... 27 5.8 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 27 5.8 At1g32130.1 68414.m03953 IWS1 C-terminus family protein contains... 27 5.8 At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1... 27 7.7 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 27 7.7 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 27 7.7 At4g16280.1 68417.m02469 flowering time control protein / FCA ga... 27 7.7 At3g46800.1 68416.m05080 DC1 domain-containing protein contains ... 27 7.7 >At3g60380.1 68416.m06753 expressed protein Length = 743 Score = 34.7 bits (76), Expect = 0.038 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 3/97 (3%) Frame = +3 Query: 237 MGNFHNSNFSDIGYPQ-MGGYDQNFNANSNSQ-QYGSESGDNYPTNNSISGNE-NSYDSQ 407 +G+ + SNF I + + +S+SQ Y S++ + + + S+S NS + Sbjct: 266 IGDNYPSNFQPISVDETLKSISSRSTGSSSSQTSYASQNQNRFSPSRSVSAESLNSNVEE 325 Query: 408 IFEQIAKQKKENIEDPDLSNLPNVNFSVPPPGFKPLD 518 + ++ ++Q P L P+++ S P P P D Sbjct: 326 LVKEKSRQSSSRSSSPSLPPSPSLSPSPPSPELVPND 362 >At1g15780.1 68414.m01893 expressed protein Length = 1335 Score = 31.1 bits (67), Expect = 0.47 Identities = 18/66 (27%), Positives = 29/66 (43%) Frame = +3 Query: 3 MKSPTSSYQDYQNALISQHANAISHLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKH 182 ++S + Q + L QH Q K F+ Q Q Q QQ QQL+ ++ Sbjct: 811 LQSNVNQPQLSSSLLQHQHLKQQQDQQMQLKQQFQQRQMQQQQLQARQQQQQQQLQARQQ 870 Query: 183 ALEMQK 200 A ++Q+ Sbjct: 871 AAQLQQ 876 >At1g62220.1 68414.m07018 expressed protein Length = 153 Score = 30.3 bits (65), Expect = 0.82 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +3 Query: 315 NSNSQQYGSESGDNYPTNNSISGNENSYDSQIFEQIAKQKKENIEDPDLS 464 +S+S Y S +G N P + EN Y S + IAK +K + S Sbjct: 56 SSSSDVYSSATGFNNPKGPDANAYENGYTSTSGQVIAKGRKARVSSASAS 105 >At1g55080.1 68414.m06291 expressed protein Length = 244 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 75 HLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 200 HL QQ ++ + Q Q Q MQQ QQ + Q+H ++ Q+ Sbjct: 53 HLQQQQQT--QQQQQQFQPQQQQEMQQYQQFQQQQHFIQQQQ 92 >At1g25540.1 68414.m03171 phytochrome and flowering time regulatory protein (PFT1) PMID: 12815435 Length = 836 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/58 (31%), Positives = 23/58 (39%) Frame = +3 Query: 27 QDYQNALISQHANAISHLTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 200 Q Q I Q HL QQ + Q QHQ QQ Q ++Q H + Q+ Sbjct: 692 QQQQQQQIQQQQQQQQHLQQQQMPQLQQQQQQHQQ---QQQQQHQLSQLQHHQQQQQQ 746 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 29.1 bits (62), Expect = 1.9 Identities = 22/89 (24%), Positives = 36/89 (40%), Gaps = 5/89 (5%) Frame = +3 Query: 231 SNMGNFHNSNFSDIGYPQMGGYDQNFNANSNSQQYGSESGDNYPT----NNSISGNENSY 398 +N N N P + +++FN N ++ + +NY T N + N N Y Sbjct: 103 NNNKNDEKVNSKTFSTPSLSETEESFN---NYEENYPKKTENYGTKGYNNEEFNNNNNKY 159 Query: 399 DSQIFEQIAKQK-KENIEDPDLSNLPNVN 482 D+ E+ K EN + +N N N Sbjct: 160 DANFKEEFNNNKYDENYAKEEFNNNNNNN 188 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/66 (21%), Positives = 28/66 (42%) Frame = +3 Query: 246 FHNSNFSDIGYPQMGGYDQNFNANSNSQQYGSESGDNYPTNNSISGNENSYDSQIFEQIA 425 ++N F++ + + FN N + Y E +N NN+ + YD + E+ Sbjct: 147 YNNEEFNNNNNKYDANFKEEFNNNKYDENYAKEEFNN---NNNNNNYNYKYDENVKEESF 203 Query: 426 KQKKEN 443 + E+ Sbjct: 204 PENNED 209 >At5g62570.1 68418.m07852 calmodulin-binding protein similar to calmodulin-binding protein TCB60 GI:1698548 from [Nicotiana tabacum] Length = 487 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = +3 Query: 9 SPTSSYQDYQNALISQHANAISHLTQQTKSTFENYQSQHQAFVG 140 +P Y+DY N H + + +S +++ SQ A VG Sbjct: 415 TPHGLYEDYDNLWNCSHILGLEEPQSELQSALDDFMSQKNASVG 458 >At5g18270.2 68418.m02148 no apical meristem (NAM) family protein contains Pfam PF02365 : No apical meristem (NAM) protein; similar to cup-shaped cotyledon CUC2 (GI:1944132) [Arabidopsis thaliana] Length = 335 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 Query: 267 DIGYPQMGGYDQNFNANSNSQQYGSESGDNYPTNNSISGNENS 395 DI P + ++ + N Q +GS SG Y NN + E S Sbjct: 234 DISSPIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQS 276 >At5g18270.1 68418.m02147 no apical meristem (NAM) family protein contains Pfam PF02365 : No apical meristem (NAM) protein; similar to cup-shaped cotyledon CUC2 (GI:1944132) [Arabidopsis thaliana] Length = 335 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +3 Query: 267 DIGYPQMGGYDQNFNANSNSQQYGSESGDNYPTNNSISGNENS 395 DI P + ++ + N Q +GS SG Y NN + E S Sbjct: 234 DISSPIQPHHFNSYQSIFNHQVFGSASGSTYNNNNEMIKMEQS 276 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +3 Query: 231 SNMGNFHNSNFSDIGYPQMGGYDQNFNANSNSQQYGSESGDNYPTNNSISGNENS 395 +N N +N+N ++ G N N +N+ + DN NN+ + N+N+ Sbjct: 80 NNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNN 134 >At3g14320.1 68416.m01811 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 204 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 279 PQMGGYDQNFNANSNSQQYGSESGDNYPTN 368 P++GG D++FN N + E + PTN Sbjct: 142 PELGGRDKSFNQNHDQTSEHHEFSTDPPTN 171 >At3g10360.1 68416.m01242 pumilio/Puf RNA-binding domain-containing protein similar to RNA binding protein PufA GB:AAD39751 [Dictyostelium discoideum] and similar to Pumilio protein GB:A46221 [Drosophila sp.] Length = 1003 Score = 27.5 bits (58), Expect = 5.8 Identities = 20/86 (23%), Positives = 36/86 (41%) Frame = +3 Query: 243 NFHNSNFSDIGYPQMGGYDQNFNANSNSQQYGSESGDNYPTNNSISGNENSYDSQIFEQI 422 N N N + + GGY NS ++ Y +E ++ T + G+ S +++ Q+ Sbjct: 464 NIRNGNINGTDFSTAGGYMAKNKLNSLAEHYSAEG--SHLTGD---GDRQSL-NRLINQV 517 Query: 423 AKQKKENIEDPDLSNLPNVNFSVPPP 500 A + + DP S + S P Sbjct: 518 ASELHSPVMDPHYSQYLHTASSTAAP 543 >At2g45620.1 68415.m05672 nucleotidyltransferase family protein low similarity to SP|O13833| Caffeine-induced death protein 1 {Schizosaccharomyces pombe}; contains Pfam profiles PF03828: PAP/25A associated domain, PF01909: Nucleotidyltransferase domain Length = 764 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 4/52 (7%) Frame = +3 Query: 333 YGSESGDNYPTNNSISGNENSYDSQIFEQIAKQKKENIE----DPDLSNLPN 476 +GS SGD + N + YDS EQ+ + + + DP+LS+ N Sbjct: 157 FGSFSGDATQSLNGLHNGNLKYDSNQHEQLMRHPQSTLSNSNMDPNLSHHRN 208 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 429 QKKENIEDPDLSNLPNVNFSVPPPGFKPL 515 Q+++N+ N+P S PPPGF P+ Sbjct: 285 QQQQNMSMYAGQNMPFYGHSQPPPGFNPM 313 >At1g32130.1 68414.m03953 IWS1 C-terminus family protein contains Pfam PF05909: IWS1 C-terminus; Length = 404 Score = 27.5 bits (58), Expect = 5.8 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 5/74 (6%) Frame = +3 Query: 249 HNSNFSDIGYPQMGGYDQNFNANSN---SQQYGSESGDNYPTN--NSISGNENSYDSQIF 413 HN + G M D NF ++ S++YG ++GD PT+ + G + + +F Sbjct: 58 HNPENDEEGVRTMD--DDNFIDDTGLDPSERYGGDAGDRSPTHYPQAEEGEDEDEVNNLF 115 Query: 414 EQIAKQKKENIEDP 455 ++ K+KK+ +P Sbjct: 116 -KMGKKKKKTERNP 128 >At5g48410.1 68418.m05986 glutamate receptor family protein (GLR1.3) plant glutamate receptor family, PMID:11379626 Length = 860 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -3 Query: 210 FLEFFASQGHVFAFPIVVFVALCDQQKLGVVIDN 109 F F G FAF + V V LC + K +++DN Sbjct: 787 FRGLFIIIGVSFAFALAVLVILCLRDKWEILVDN 820 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 27.1 bits (57), Expect = 7.7 Identities = 16/38 (42%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +3 Query: 270 IGYP-QMGGYDQNFN--ANSNSQQYGSESGDNYPTNNS 374 IG P G + N N +NSNSQQ+ SG +P + S Sbjct: 534 IGSPINQGSHRGNLNLWSNSNSQQHNQSSGMMWPNSPS 571 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 78 LTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 200 L+QQT+S +QS QA + QQ+Q ++ L + + Sbjct: 511 LSQQTQSLQATFQSSQQA-ISQLQQQVQSMQQPNQNLPLSQ 550 >At4g16280.1 68417.m02469 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 505 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = +3 Query: 78 LTQQTKSTFENYQSQHQAFVGHTMQQIQQLEMQKHALEMQK 200 L+QQT+S +QS QA + QQ+Q ++ L + + Sbjct: 269 LSQQTQSLQATFQSSQQA-ISQLQQQVQSMQQPNQNLPLSQ 308 >At3g46800.1 68416.m05080 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 682 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 2/32 (6%) Frame = -2 Query: 136 TKAWCCD**FSKVDLVCCVRCE--IAFACCEI 47 TK CD +S D++CC CE + F C + Sbjct: 523 TKCSACDITYSARDMLCCDECEFRLDFRCATL 554 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,845,457 Number of Sequences: 28952 Number of extensions: 147581 Number of successful extensions: 686 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -