BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303H03f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|c... 27 1.7 SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyc... 25 5.2 >SPAC27E2.03c |||GTP binding protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 392 Score = 27.1 bits (57), Expect = 1.7 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 336 ETAFNTCKN*TAKCKVVSCVVLGYLKENVTNHIYCG 443 E A CK K + +V GY N+ N+ CG Sbjct: 279 EEAIEECKKLNTKSMLPKIIVTGYNALNLINYFTCG 314 >SPAC105.01c |||potassium ion/proton antiporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 898 Score = 25.4 bits (53), Expect = 5.2 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +2 Query: 38 LARSYSSLLIIPYLKNVDKSVESRRS 115 L +S S++LI+PYLK+ K++E+ S Sbjct: 559 LKKSSSNILIMPYLKDY-KTIENESS 583 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,945,964 Number of Sequences: 5004 Number of extensions: 36326 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 58 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -