BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303H03f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3810| Best HMM Match : PEPCK (HMM E-Value=0) 29 2.3 SB_49059| Best HMM Match : UPF0175 (HMM E-Value=5.9) 27 9.4 >SB_3810| Best HMM Match : PEPCK (HMM E-Value=0) Length = 707 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/68 (26%), Positives = 31/68 (45%) Frame = -1 Query: 206 VSSFRK*RDRTVGTVGRFVKSEINMCMFISRFVVIQRTCLRFSNRELLKVTNSFELIYVR 27 V F+K +D VG +GR++ E RF + C+ + ++L ++I V Sbjct: 235 VPDFKKGKDGVVGQLGRWLSVEKANQALGERFPGCMKACIGYDVYQVLTDVVKPKIIVVA 294 Query: 26 YKSKSFTE 3 Y+S E Sbjct: 295 YESLKIKE 302 >SB_49059| Best HMM Match : UPF0175 (HMM E-Value=5.9) Length = 159 Score = 27.1 bits (57), Expect = 9.4 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 393 VVLGYLKENVTNHIYCGFLIKQSSDRYRR 479 V+L L H+YCG ++ S +R R+ Sbjct: 5 VILAKLNRETQAHVYCGTTLRSSLNRARK 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,836,372 Number of Sequences: 59808 Number of extensions: 245285 Number of successful extensions: 428 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -