BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303H03f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 4.7 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 4.7 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 144 GFNKPPDCTYCAIALLPKGAH 206 GF + PDC C A +P+ AH Sbjct: 1001 GFTESPDCRSC--AGVPENAH 1019 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 4.7 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 120 YKHAHIYFGFNKPPDCTYCAIALLPKGAHVTGE 218 ++ H+ FGF PDC CA + AHV E Sbjct: 938 HEFLHV-FGFAPSPDCPRCA-GSVESVAHVMFE 968 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,033 Number of Sequences: 2352 Number of extensions: 8776 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -