BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G12f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0322 - 2451062-2451601,2451691-2451792,2452237-2452329,245... 33 0.18 03_03_0008 - 13674602-13674708,13675272-13675439,13676169-136767... 31 0.74 03_02_0545 + 9373344-9374963 30 1.3 12_01_1078 - 11202284-11202343,11202941-11203000,11203036-112030... 29 1.7 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 29 1.7 04_03_0182 - 12349072-12349149,12349459-12349656,12349746-123497... 29 2.3 01_06_1577 - 38379951-38380167,38380349-38380543,38380919-383811... 29 3.0 07_01_0516 - 3850252-3852870 28 4.0 01_01_0896 + 7060431-7061390,7063562-7064191 28 4.0 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 28 5.2 05_03_0458 + 14280953-14281866,14281964-14282912 28 5.2 04_03_0799 - 19805190-19805749,19806316-19806403 28 5.2 03_05_0543 - 25404630-25405408,25405461-25405605 28 5.2 11_01_0359 - 2731522-2732346 27 6.9 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 27 6.9 06_03_0927 + 26015956-26018230,26018323-26018471,26018550-260186... 27 6.9 11_06_0510 + 24420402-24422582 27 9.1 06_03_1057 + 27248249-27249001 27 9.1 06_03_0986 - 26574083-26574952 27 9.1 04_04_0179 - 23342764-23342973,23343185-23343340,23343535-233435... 27 9.1 03_04_0034 + 16679624-16679940,16679980-16680199,16680319-166806... 27 9.1 >12_01_0322 - 2451062-2451601,2451691-2451792,2452237-2452329, 2452443-2452589,2453063-2453150,2453338-2453426, 2453698-2453763,2453962-2454076,2454269-2454462 Length = 477 Score = 32.7 bits (71), Expect = 0.18 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 193 PDVGVEEDSD-ELALDQEETRNLRPRAYTPTAYNALPSGFRPTPSL 327 P +G +D EL + E NL PRA TP+ LP+ PTP+L Sbjct: 416 PRIGCVKDYPMELRMQALEMVNLSPRASTPSPSWRLPACLSPTPNL 461 >03_03_0008 - 13674602-13674708,13675272-13675439,13676169-13676787, 13676868-13677330,13677855-13678036,13678093-13678235, 13678315-13678423,13679000-13679456,13680490-13682473, 13682507-13682626,13682920-13682971 Length = 1467 Score = 30.7 bits (66), Expect = 0.74 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = -2 Query: 328 PGKVLDGSRWAERCMQSACKHADEDSLFPPDPEPVHRCLPPLPRQVYCLLHPKPSPL 158 P +V +R + + C+ +D +L PP P+ PPLP + P P+P+ Sbjct: 1088 PSEVEASTRCRPEQIDTKCRTSDRHTLGPPLPDDRPPSPPPLPSSPPPVPPPPPAPI 1144 >03_02_0545 + 9373344-9374963 Length = 539 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = -2 Query: 268 HADEDSLFPPDPEPVHRCL---PPLPRQVYCLLHPKPSPLRPA 149 H D D PP P P RCL P + L PSP PA Sbjct: 34 HDDFDLFLPPPPGPFRRCLHAAAAAPPDINLPLDADPSPPPPA 76 >12_01_1078 - 11202284-11202343,11202941-11203000,11203036-11203050, 11203322-11204026 Length = 279 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/60 (26%), Positives = 22/60 (36%) Frame = -2 Query: 193 VYCLLHPKPSPLRPAKVLRENSTSFPLSRTEKLSVKNYNTDFCIRQKAREMTETRQRLPR 14 V C P P PLRP+ + S P S + + +AR + LPR Sbjct: 40 VRCAHSPSPHPLRPSAATADEEVSLPPSLRVSRLAEEFRVSPDAADRARRLLARAAALPR 99 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/68 (32%), Positives = 31/68 (45%) Frame = -2 Query: 334 VQPGKVLDGSRWAERCMQSACKHADEDSLFPPDPEPVHRCLPPLPRQVYCLLHPKPSPLR 155 VQPG +G ++ SA A ++ L PP P P LPP P+ + P P P Sbjct: 515 VQPGS--NGMLLQDQPHVSAHPSASKNML-PPPPPPPRNMLPPPPKSM-----PPPPPKF 566 Query: 154 PAKVLREN 131 P+ + N Sbjct: 567 PSNEMSRN 574 >04_03_0182 - 12349072-12349149,12349459-12349656,12349746-12349750, 12349928-12350041,12350129-12350240,12350363-12350377 Length = 173 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/81 (20%), Positives = 33/81 (40%) Frame = +2 Query: 149 CWSEWRWLRMKKTVYLTWEWRKTAMNWLWIRRKQGIFVRVLTRRLHTTLCPAASVQHLPW 328 C+ WRW V+ + A+N +WI + RV + HT+ ++ + Sbjct: 44 CYKLWRWGTQMIKVFSKIKMNALAINVIWIEAQLNCIGRVFLQ--HTSAWAHIGIKRMGE 101 Query: 329 LNWLGTNNGHNSRSSKNTSYL 391 L+ + N +S + + L Sbjct: 102 LDIIAFKNAVKQKSPEEAAIL 122 >01_06_1577 - 38379951-38380167,38380349-38380543,38380919-38381191, 38381281-38381455,38381925-38382035,38382120-38382390, 38382990-38383139,38383242-38384246 Length = 798 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 344 TNNGHNSRSSKNTSYLPGSNSKFTSKNLERPSELSRESLKSKD 472 T+N N+ + + +P KF+ +E+P E S E K+ Sbjct: 82 TDNNDNAVPEEPNNTVPSEEEKFSENTVEKPVESSEEKAPPKE 124 >07_01_0516 - 3850252-3852870 Length = 872 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = -2 Query: 280 SACKHADEDSLFPPDPEPVHRCLPPLPRQVYCLLHPKPSPLR 155 S A L PP P P R LPP P P P P R Sbjct: 4 STSSAAPPPRLLPPQPPPTSRPLPPPPPPPPPAHGPSPPPPR 45 >01_01_0896 + 7060431-7061390,7063562-7064191 Length = 529 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +2 Query: 320 LPWLNWLGTNNGHNSRSSKNTSYLPGSNSKFTSKNLERPSELSRE 454 LPWL W+ NG + + L G K + R E+ R+ Sbjct: 236 LPWLGWVDALNGMEVKVQRTFEALDGILEKVIDDHRRRRREVGRQ 280 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 247 FPPDPEPVHRCLPPLPRQVYCLLHPKPSPLRP 152 F P P P PPLP+ Y P P P P Sbjct: 561 FSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 27.9 bits (59), Expect = 5.2 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = -2 Query: 244 PPDPEPVHRCLPPL-PRQVYCLLHPKPSPLRPAKVLRENSTSFP 116 PP P+ PPL P + C HP P P P+ +++S P Sbjct: 65 PPPLPPLQPTPPPLPPTTLSCSSHPTPPP-PPSPTTSPSASSLP 107 >04_03_0799 - 19805190-19805749,19806316-19806403 Length = 215 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = -2 Query: 241 PDPEPVHRCLPPLPRQVY--CLLHPKPSP 161 P P P C PP Q Y C PKP P Sbjct: 106 PAPPPPPACCPPSTHQCYHCCPAPPKPKP 134 >03_05_0543 - 25404630-25405408,25405461-25405605 Length = 307 Score = 27.9 bits (59), Expect = 5.2 Identities = 22/76 (28%), Positives = 33/76 (43%) Frame = -2 Query: 244 PPDPEPVHRCLPPLPRQVYCLLHPKPSPLRPAKVLRENSTSFPLSRTEKLSVKNYNTDFC 65 P P P R P PR+ P P+PL PA R + P E ++ K + Sbjct: 142 PAAPLPGVRTPPSPPRRAPA---PAPAPLTPALSQRFLAERRPAPVPEPVTRKRSDLGTL 198 Query: 64 IRQKAREMTETRQRLP 17 ++ K ++ ET + LP Sbjct: 199 MKPKEDKVEETTKPLP 214 >11_01_0359 - 2731522-2732346 Length = 274 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = -2 Query: 268 HADEDSLFPPDPEPVHRCLPPLPRQVYCL 182 HA +PP P P H PP P CL Sbjct: 58 HAYHHHHYPPPPPPHHHPYPPHPPPPTCL 86 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = -2 Query: 244 PPDPEPVHRCLPPLPRQVYCLLHPKPSPLRPA 149 PP P C PPLP P P PL P+ Sbjct: 1147 PPLPSDSPPCQPPLPPSPPPATPPPPPPLSPS 1178 >06_03_0927 + 26015956-26018230,26018323-26018471,26018550-26018618, 26018701-26018853,26018927-26019090,26019207-26019354, 26020348-26020470,26020560-26020647,26020781-26020950 Length = 1112 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 154 PAKVLRENSTSFPLSRTEKLSVKNYNTDFCIRQ 56 P + ENS FP +R ++S N NT F + + Sbjct: 536 PQNAIPENSQGFPDTRAREVSQSNTNTFFDVSE 568 >11_06_0510 + 24420402-24422582 Length = 726 Score = 27.1 bits (57), Expect = 9.1 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = +2 Query: 152 WSEWRWLRMKKTVYLTWEWR 211 W EWRW KT++ +W ++ Sbjct: 413 WLEWRWNFRVKTMWDSWRYK 432 >06_03_1057 + 27248249-27249001 Length = 250 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 259 RPRAYTPTAYNALPSGFRPTPS 324 RP A PTA +P+G +P PS Sbjct: 25 RPAATVPTAPAVIPAGSQPAPS 46 >06_03_0986 - 26574083-26574952 Length = 289 Score = 27.1 bits (57), Expect = 9.1 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 241 PDPEPVHRCLPPLPRQVYCLLHPKPSPL-RPAKVL 140 P P P+ PPLPR + P P+P+ P K++ Sbjct: 200 PGPGPLPLPSPPLPRMKPMAIAPTPAPVPAPTKMV 234 >04_04_0179 - 23342764-23342973,23343185-23343340,23343535-23343593, 23344150-23344226,23344309-23344587,23344800-23344885, 23344960-23345027,23345721-23345904,23346071-23346204, 23346776-23347039,23347613-23347677,23347833-23348407, 23348501-23348680,23348765-23348928,23349008-23349261, 23349405-23349562,23349808-23349948,23350176-23350282, 23350651-23350737,23350812-23350901,23350974-23351055, 23351370-23351561,23351748-23351816,23351959-23352294, 23352694-23352837,23352963-23353126,23353817-23353883 Length = 1463 Score = 27.1 bits (57), Expect = 9.1 Identities = 16/36 (44%), Positives = 20/36 (55%) Frame = -2 Query: 262 DEDSLFPPDPEPVHRCLPPLPRQVYCLLHPKPSPLR 155 D +S+ PP P+H PLPR+V C L S LR Sbjct: 1206 DNESVSPP---PLHLEGAPLPREVLCTLPCVGSVLR 1238 >03_04_0034 + 16679624-16679940,16679980-16680199,16680319-16680624, 16680703-16681044,16681066-16681257,16681533-16681684, 16681803-16681974,16682017-16682338,16682414-16682862 Length = 823 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -2 Query: 313 DGSRWAERCMQSACKHADEDSL-FPPDP 233 D RW E M + AD+D++ PP P Sbjct: 73 DSDRWPEMAMYAGMLQADDDNIEIPPPP 100 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,292,836 Number of Sequences: 37544 Number of extensions: 309445 Number of successful extensions: 1435 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1309 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -