BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G10f (435 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccha... 27 1.6 SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pomb... 26 2.9 SPAC57A7.11 |mip1||WD repeat protein Mip1|Schizosaccharomyces po... 25 3.8 SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces po... 25 3.8 SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Ph... 25 6.7 SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|ch... 25 6.7 SPBC1604.06c |||CBF/Mak21 family|Schizosaccharomyces pombe|chr 2... 25 6.7 >SPAC16.04 |dus3||tRNA dihydrouridine synthase Dus3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 617 Score = 26.6 bits (56), Expect = 1.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +3 Query: 39 AECVVSLPATKDKPKPQTKAANAPPE 116 AE ++S ++KP P +K +N P E Sbjct: 150 AESIISAVLGEEKPDPSSKVSNIPEE 175 >SPBP4H10.10 |||rhomboid family protease|Schizosaccharomyces pombe|chr 2|||Manual Length = 392 Score = 25.8 bits (54), Expect = 2.9 Identities = 16/48 (33%), Positives = 27/48 (56%) Frame = +1 Query: 160 LLSSAVRSLGNLFQQYSGTRVIN*LNHQNTSKCRGLLMNTPCVYQKLS 303 +++ A SL NL++ T V++ +HQN + LL+N +Y LS Sbjct: 153 MMTHAQASLFNLYEGRWWTLVVSIFSHQNLAH---LLVNCVAIYSFLS 197 >SPAC57A7.11 |mip1||WD repeat protein Mip1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1313 Score = 25.4 bits (53), Expect = 3.8 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -3 Query: 412 EDYQPGRGCVTFQXWQRQSHDQRSYMPHIXSPLSSSGK 299 ED +PG C + W+R +++ Y + S++G+ Sbjct: 942 EDDEPGSICYNQRLWRRNRNEKLIYRTRPLAEYSTNGR 979 >SPBC336.01 |fbh1|fdh1, fdh|DNA helicase I|Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 25.4 bits (53), Expect = 3.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 55 AFQLLRTNLNLKRKQQMPHPRLSN 126 AFQLLR+ L Q+ HP+L + Sbjct: 632 AFQLLRSGSELAHGQRPSHPKLKD 655 >SPAC30D11.08c |phf2|swp2, saf60|PHD finger containing protein Phf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 538 Score = 24.6 bits (51), Expect = 6.7 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 207 QWYKGDKLIKPSKYFQMSRTADEYTLRISEAFP 305 Q+ + +K+ +Y Q DE L++ E+FP Sbjct: 401 QYMESEKIPTIDEYLQEYSNEDEIVLQVLESFP 433 >SPAC11D3.05 |||membrane transporter|Schizosaccharomyces pombe|chr 1|||Manual Length = 546 Score = 24.6 bits (51), Expect = 6.7 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 280 VYSSAVLDIWKYFDGLISLSPLYHCTVGRGF 188 VYSS ++DI I +S L CT GF Sbjct: 125 VYSSGIIDIASELHSSIPVSTLGSCTFLVGF 155 >SPBC1604.06c |||CBF/Mak21 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 485 Score = 24.6 bits (51), Expect = 6.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 9 INSAGEARCDAECVVSLPATKDKPKPQTKAANA 107 +N A A C C +S +PK +ANA Sbjct: 36 VNDAAAALCRVYCYLSRNGLLKRPKEDDSSANA 68 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,776,222 Number of Sequences: 5004 Number of extensions: 34761 Number of successful extensions: 94 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -