BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G06f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6255| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) 28 5.4 >SB_6255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 526 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 404 VTF*PRYIIWSHCLISFSSVRSI 472 +TF P Y IW+HC +++S V + Sbjct: 440 LTFCPFYRIWTHCTVTWSPVSGL 462 >SB_13434| Best HMM Match : C4dic_mal_tran (HMM E-Value=0.52) Length = 835 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -2 Query: 307 STGTHFVTSNSNIPHYGRQCARCCLSLHKTS 215 ST THFVT + P +G AR C H S Sbjct: 37 STNTHFVTQGNLTPSFGN--ARSCRIQHNAS 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,125,438 Number of Sequences: 59808 Number of extensions: 334264 Number of successful extensions: 597 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 597 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -