BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G03f (312 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 22 4.6 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 22 4.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 22 6.1 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 21 8.1 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 21 8.1 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 40 PRVILRQFSTFTTSQLPIPRRVIQFSRDSRTTHRG 144 P V+ R F+ T+Q P P Q + + HRG Sbjct: 139 PSVLRRNFA-LKTAQTPDPSFQSQLMNQTSSFHRG 172 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.2 bits (45), Expect = 4.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 40 PRVILRQFSTFTTSQLPIPRRVIQFSRDSRTTHRG 144 P V+ R F+ T+Q P P Q + + HRG Sbjct: 144 PSVLRRNFA-LKTAQTPDPSFQSQLMNQTSSFHRG 177 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +2 Query: 152 CIQVPCDNGVLYGYPVHNP 208 C++V C+N LY V+ P Sbjct: 173 CVRVACNNAHLYVMVVYIP 191 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -1 Query: 141 AVSCTRIATKLDDAP 97 A+SC +A+K+++AP Sbjct: 124 AMSCICLASKIEEAP 138 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 21.4 bits (43), Expect = 8.1 Identities = 7/15 (46%), Positives = 13/15 (86%) Frame = -1 Query: 141 AVSCTRIATKLDDAP 97 A+SC +A+K+++AP Sbjct: 124 AMSCICLASKIEEAP 138 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 345,957 Number of Sequences: 2352 Number of extensions: 6671 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 20316549 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -