BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G03f (312 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3283|AAM71018.2| 2968|Drosophila melanogaster CG13492-P... 29 1.2 AE013599-3282|AAF46766.2| 2931|Drosophila melanogaster CG13492-P... 29 1.2 >AE013599-3283|AAM71018.2| 2968|Drosophila melanogaster CG13492-PB, isoform B protein. Length = 2968 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -1 Query: 150 CIAAVSCTRIATKLDDAPGNWQLTCCKSAKLSENYAGRGCN*A-LRGNV 7 C A SC + T++ GN + TC RGC+ A L NV Sbjct: 1285 CSDAASCATVGTEITKCEGNNKQTCSTVFNSEGQVVARGCSDAVLAANV 1333 >AE013599-3282|AAF46766.2| 2931|Drosophila melanogaster CG13492-PA, isoform A protein. Length = 2931 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/49 (32%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -1 Query: 150 CIAAVSCTRIATKLDDAPGNWQLTCCKSAKLSENYAGRGCN*A-LRGNV 7 C A SC + T++ GN + TC RGC+ A L NV Sbjct: 1248 CSDAASCATVGTEITKCEGNNKQTCSTVFNSEGQVVARGCSDAVLAANV 1296 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,657,429 Number of Sequences: 53049 Number of extensions: 283961 Number of successful extensions: 571 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 610819518 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -