BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G03f (312 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09340.1 68416.m01108 amino acid transporter family protein l... 29 0.87 At3g09330.1 68416.m01107 amino acid transporter family protein b... 29 0.87 At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00... 27 3.5 At4g10770.1 68417.m01757 oligopeptide transporter OPT family pro... 25 8.1 At1g01310.1 68414.m00047 allergen V5/Tpx-1-related family protei... 25 8.1 >At3g09340.1 68416.m01108 amino acid transporter family protein low similarity to vesicular GABA transporter [Rattus norvegicus] GI:2587061; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 528 Score = 28.7 bits (61), Expect = 0.87 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 117 SRFAYNSPRRYTASKYLVTTASYMVILYIIHVIVISPL 230 S+F N P++YTASK V TA +V+ + + ++P+ Sbjct: 381 SQFTLNMPQQYTASKIAVWTA--VVVPMTKYALALTPI 416 >At3g09330.1 68416.m01107 amino acid transporter family protein belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 524 Score = 28.7 bits (61), Expect = 0.87 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +3 Query: 117 SRFAYNSPRRYTASKYLVTTASYMVILYIIHVIVISPL 230 S+F N P++YTASK V TA +V+ + + ++P+ Sbjct: 381 SQFTLNMPQQYTASKIAVWTA--VVVPMTKYALALTPI 416 >At3g22700.1 68416.m02864 F-box family protein contains Pfam:PF00646 F-box domain Length = 338 Score = 26.6 bits (56), Expect = 3.5 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = -1 Query: 60 LSENYAGRGCN*ALRGNVY 4 ++ NY GR C +L+GN+Y Sbjct: 192 VNHNYLGRCCRVSLKGNIY 210 >At4g10770.1 68417.m01757 oligopeptide transporter OPT family protein similar to oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 766 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/30 (33%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 176 GVLY-GYPVHNPCYSDFAFTTVVYVLXFCQ 262 G +Y GYPV N C+ + + ++ + F Q Sbjct: 516 GYIYPGYPVANMCFKVYGYISMQQAITFLQ 545 >At1g01310.1 68414.m00047 allergen V5/Tpx-1-related family protein similar to pathogenesis related protein-1 GB:AAC25629 GI:3290004 from [Zea mays]; contains Pfam profile PF00188: SCP-like extracellular protein Length = 241 Score = 25.4 bits (53), Expect = 8.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 146 IHCIQVPCDNGVLYGYPVHNP 208 + C V C NG +Y V+NP Sbjct: 189 VGCASVDCSNGGVYAICVYNP 209 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,996,522 Number of Sequences: 28952 Number of extensions: 131793 Number of successful extensions: 233 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 233 length of database: 12,070,560 effective HSP length: 70 effective length of database: 10,043,920 effective search space used: 331449360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -