BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303G01f (338 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) 27 2.9 SB_50904| Best HMM Match : NACHT (HMM E-Value=2.3e-05) 26 6.8 >SB_4940| Best HMM Match : DUF755 (HMM E-Value=2.3) Length = 173 Score = 27.5 bits (58), Expect = 2.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 56 LVHGSRRVHRARRGCLHRSAGLLSLHRASSSL 151 + H +R+HR R HR+ HR SSSL Sbjct: 124 MTHNQKRIHRRRHNHHHRNHQHHYHHRLSSSL 155 >SB_50904| Best HMM Match : NACHT (HMM E-Value=2.3e-05) Length = 1122 Score = 26.2 bits (55), Expect = 6.8 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = +2 Query: 215 RNYVSTLSAEINKPIYLLPE*KKKKKNSRGGPVPNSPYSES 337 R + +S E + LP KKK+ G + N+P+SE+ Sbjct: 948 REAIMDISRETRNICFGLPVEKKKQMIGEGEHIRNNPFSEN 988 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,224,040 Number of Sequences: 59808 Number of extensions: 70351 Number of successful extensions: 128 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 128 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 485763447 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -