BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F11f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0151 - 1158834-1159703,1159917-1160092,1160144-1162097,116... 28 4.0 05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-22... 28 4.0 >12_01_0151 - 1158834-1159703,1159917-1160092,1160144-1162097, 1162360-1162620,1162729-1162916,1164127-1164166 Length = 1162 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 6/33 (18%) Frame = -2 Query: 142 HLSYYCFSHINC------VCWCWNVEFNHNFYC 62 +LSY+ SH +C + CWN++ H YC Sbjct: 492 YLSYFRISHASCRAFPEEISHCWNLQALHVTYC 524 >05_01_0033 + 220125-220190,220274-224445,224863-224949,225048-225084, 225296-225356,225666-226918 Length = 1891 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -2 Query: 154 GNQAHLSYYCFSHINCVC 101 GN A YCF H C+C Sbjct: 1866 GNMARFDAYCFQHNKCLC 1883 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,395,372 Number of Sequences: 37544 Number of extensions: 162910 Number of successful extensions: 262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 259 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -