BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F10f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 23 2.2 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 2.9 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 22.6 bits (46), Expect = 2.2 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 174 LFRTITCVIIAILIRGIYLGQTKVSNVRHVERLLTNY 64 +F +TC + L + + ++ ERLL NY Sbjct: 5 VFLVLTCAHVVFLEEYVIPDNIDIDDILSNERLLKNY 41 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 22.2 bits (45), Expect = 2.9 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 237 NCGKWLFASMMHCFQYC 187 NC L+A M++C++ C Sbjct: 718 NCSPDLYAVMLNCWKEC 734 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,568 Number of Sequences: 336 Number of extensions: 1984 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -