BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0503 - 18170645-18170858,18171029-18171222,18171419-181716... 29 1.7 04_04_0207 + 23602065-23604315,23604611-23605116 28 4.0 >09_04_0503 - 18170645-18170858,18171029-18171222,18171419-18171629, 18172162-18172553,18172926-18173054,18173353-18173487, 18173885-18174088,18174716-18174771,18174793-18174950, 18175864-18176231 Length = 686 Score = 29.5 bits (63), Expect = 1.7 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 14 WKIN*QNGKFEYCCPHQNPILFVLTNAP 97 W + ++ K +Y H N ++LTNAP Sbjct: 208 WPVQKRSDKVQYFLEHHNGFFYILTNAP 235 >04_04_0207 + 23602065-23604315,23604611-23605116 Length = 918 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = +1 Query: 169 KIYCYSIRDSQTILGKRFVIQNNVDFKTLKILSQVFIPMKIKYLS 303 K+Y ++D Q I K+F+ +N F +K + F ++ K ++ Sbjct: 590 KVYLIELQDGQNIAVKKFICSSNQTFGAVKNHMKTFAKIRHKNIA 634 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,488,464 Number of Sequences: 37544 Number of extensions: 201187 Number of successful extensions: 275 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 275 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -