BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F09f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z83218-2|CAB05687.1| 705|Caenorhabditis elegans Hypothetical pr... 29 1.5 AF067942-4|AAG45573.2| 324|Caenorhabditis elegans Hypothetical ... 29 1.5 Z92782-11|CAE17813.1| 382|Caenorhabditis elegans Hypothetical p... 28 3.5 Z93381-6|CAB07609.1| 724|Caenorhabditis elegans Hypothetical pr... 27 8.1 Z83218-8|CAB05693.1| 724|Caenorhabditis elegans Hypothetical pr... 27 8.1 >Z83218-2|CAB05687.1| 705|Caenorhabditis elegans Hypothetical protein C31A11.5 protein. Length = 705 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 379 FSLVDFDEKIKYVKFTQLTYWKVSKL 302 FS D+D K+K+ F++ TY+ S+L Sbjct: 535 FSTYDYDNKVKWSIFSRATYYNFSRL 560 >AF067942-4|AAG45573.2| 324|Caenorhabditis elegans Hypothetical protein ZK6.6 protein. Length = 324 Score = 29.5 bits (63), Expect = 1.5 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 67 PHFICTN*CS*YSKWIY*TQTTFNTKNCFYLFIKKIYCYSIRDSQTILG 213 P F+ T + + IY T TFN N +++ IY + + +TI+G Sbjct: 104 PTFLLTGMYTAFWVSIYPTSLTFNMHNSKMIYLPAIYGFGVGVGETIMG 152 >Z92782-11|CAE17813.1| 382|Caenorhabditis elegans Hypothetical protein F14F8.11 protein. Length = 382 Score = 28.3 bits (60), Expect = 3.5 Identities = 13/26 (50%), Positives = 19/26 (73%) Frame = -3 Query: 174 YFFNK*IKTILCIESGLCSVNPL*IL 97 Y FNK I +++ +SGLC+V PL I+ Sbjct: 151 YPFNKRISSLVTSKSGLCTVIPLSII 176 >Z93381-6|CAB07609.1| 724|Caenorhabditis elegans Hypothetical protein C31A11.1 protein. Length = 724 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 379 FSLVDFDEKIKYVKFTQLTYWKVSKL 302 FS D+D K+ + F++ TY+ S+L Sbjct: 535 FSTYDYDNKVNWSIFSRATYFNFSRL 560 >Z83218-8|CAB05693.1| 724|Caenorhabditis elegans Hypothetical protein C31A11.1 protein. Length = 724 Score = 27.1 bits (57), Expect = 8.1 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = -2 Query: 379 FSLVDFDEKIKYVKFTQLTYWKVSKL 302 FS D+D K+ + F++ TY+ S+L Sbjct: 535 FSTYDYDNKVNWSIFSRATYFNFSRL 560 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,528,499 Number of Sequences: 27780 Number of extensions: 235687 Number of successful extensions: 426 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 426 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -