BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS303F04f (494 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0437 - 20765682-20765951,20766040-20766294,20766374-207665... 29 1.6 07_01_0308 + 2203597-2203774,2203886-2204066,2204141-2204282,220... 27 8.3 02_02_0009 + 6068260-6068591,6068797-6068917,6069034-6069122,606... 27 8.3 >06_03_0437 - 20765682-20765951,20766040-20766294,20766374-20766545, 20766964-20767097,20767205-20767288,20767369-20767659, 20767867-20768214,20768321-20768496,20768579-20768695, 20768780-20768936,20769110-20769225,20769323-20769483, 20769567-20769883,20769969-20770250,20770347-20770648, 20771977-20772067,20773203-20773256,20773723-20773812 Length = 1138 Score = 29.5 bits (63), Expect = 1.6 Identities = 18/44 (40%), Positives = 23/44 (52%), Gaps = 8/44 (18%) Frame = +1 Query: 10 IPFIFNQT*----IVY----FTWNVYRTFFVFLVFYTIFLYFCF 117 IP++F QT IVY F W + F+ F V Y FLYF + Sbjct: 969 IPYVFVQTAYYTLIVYAMMSFQWTAAKFFWFFFVSYFSFLYFTY 1012 >07_01_0308 + 2203597-2203774,2203886-2204066,2204141-2204282, 2204371-2204440,2204546-2204715 Length = 246 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 374 IGTLSEIFVGTDLRGFLARCAAFF 445 +GTL ++ G DL+ FL A FF Sbjct: 150 LGTLQDVSCGRDLKNFLLVIAGFF 173 >02_02_0009 + 6068260-6068591,6068797-6068917,6069034-6069122, 6069207-6069291,6069421-6069580,6069667-6069743, 6069848-6069898,6069979-6070069,6070167-6070468, 6070549-6070830,6070911-6071388,6071457-6071560, 6071647-6071809,6071895-6072017,6072099-6072217, 6072304-6072636,6072713-6073003,6073088-6073171, 6073260-6073393,6073478-6073705,6073795-6073966, 6074062-6074316,6074408-6074668 Length = 1444 Score = 27.1 bits (57), Expect = 8.3 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 9/45 (20%) Frame = +1 Query: 10 IPFIFNQT*----IVY----FTWNVYRTF-FVFLVFYTIFLYFCF 117 IP IF QT IVY F W V + F ++F +F+T F+YF F Sbjct: 1278 IPHIFLQTVVYGLIVYSLIGFDWTVEKFFWYMFFMFFT-FMYFTF 1321 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,696,998 Number of Sequences: 37544 Number of extensions: 65090 Number of successful extensions: 173 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1035514020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -